We can provide the same sequence for the cytoplasmic domain in the mouse TLR7, pls check the details as below:
Recombinant Mouse Toll-like receptor 7(Tlr7) ,partial
CSB-YP023606MO1 >> Yeast
CSB-EP023606MO1 >> E.coli
CSB-BP023606MO1 >> Baculovirus
CSB-MP023606MO1 >> Mammalian cell
Expression Region: 859-1050aa; Partial, provide the complete cytoplasmic domain.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:
TTSHLFFWDMWYIYYFWKAKIKGYQHLQSMESCYDAFIVYDTKNSAVTEWVLQELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTQKYAKTESFKMAFYLSHQRLLDEKVDVIILIFLEKPLQKSKFLQLRKRLCRSSVLEWPANPQAHPYFWQCLKNALTTDNHVAYSQMFKETV
Reference: https://www.uniprot.org/uniprot/P58681
In addition, we have developed another region of this protein, pls check the below information for your reference:
Recombinant Mouse Toll-like receptor 7(Tlr7),partial
CSB-YP023606MO >> Yeast
CSB-EP023606MO >> E.coli
CSB-EP023606MOb1 >> E.coli
CSB-BP023606MO >> Baculovirus
CSB-MP023606MO >> Mammalian cell
Expression Region: 27-348aa; Provide the fragment of the extracellular domain at the N-terminal.
Tag information:CSB-EP023606MO: N-terminal GST-tagged; CSB-EP023606MOb1: N-terminal 10xHis-tagged and C-terminal Myc-tagged;
MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged
The expected tag for other expression system: YP: N-terminal 6xHis-tagged; BP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:
FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS