Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
Choreoathetosis/spasticity episodic (paroxysmal choreoathetosis/spasticity); CSE; DYT17; DYT18; DYT9; EIG12; erythrocyte/brain; Erythrocyte/hepatoma glucose transporter; facilitated glucose transporter member 1; Glucose transporter 1; Glucose transporter type 1; Glucose transporter type 1, erythrocyte/brain; GLUT ; GLUT-1; GLUT1; GLUT1DS; GLUTB; GT1; GTG1; Gtg3; GTR1_HUMAN; HepG2 glucose transporter; HTLVR; Human T cell leukemia virus (I and II) receptor; MGC141895; MGC141896; PED; RATGTG1; Receptor for HTLV 1 and HTLV 2; SLC2A1; Solute carrier family 2 (facilitated glucose transporter), member 1; Solute carrier family 2; Solute carrier family 2, facilitated glucose transporter member 1
Species
Homo sapiens (Human)
Expression Region
207-271aa
Target Protein Sequence
CPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.