Recombinant Human Protein kinase C epsilon type (PRKCE)

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
PRKCE
Uniprot NO.
Alternative Names
Protein kinase C epsilon type; EC 2.7.11.13; nPKC-epsilon; PRKCE PKCE
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-737
Target Protein Sequence
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that plays essential roles in the regulation of multiple cellular processes linked to cytoskeletal proteins, such as cell adhesion, motility, migration and cell cycle, functions in neuron growth and ion channel regulation, and is involved in immune response, cancer cell invasion and regulation of apoptosis. Mediates cell adhesion to the extracellular matrix via integrin-dependent signaling, by mediating angiotensin-2-induced activation of integrin beta-1 (ITGB1) in cardiac fibroblasts. Phosphorylates MARCKS, which phosphorylates and activates PTK2/FAK, leading to the spread of cardiomyocytes. Involved in the control of the directional transport of ITGB1 in mesenchymal cells by phosphorylating vimentin (VIM), an intermediate filament (IF) protein. In epithelial cells, associates with and phosphorylates keratin-8 (KRT8), which induces targeting of desmoplakin at desmosomes and regulates cell-cell contact. Phosphorylates IQGAP1, which binds to CDC42, mediating epithelial cell-cell detachment prior to migration. In HeLa cells, contributes to hepatocyte growth factor (HGF)-induced cell migration, and in human corneal epithelial cells, plays a critical role in wound healing after activation by HGF. During cytokinesis, forms a complex with YWHAB, which is crucial for daughter cell separation, and facilitates abscission by a mechanism which may implicate the regulation of RHOA. In cardiac myocytes, regulates myofilament function and excitation coupling at the Z-lines, where it is indirectly associated with F-actin via interaction with COPB1. During endothelin-induced cardiomyocyte hypertrophy, mediates activation of PTK2/FAK, which is critical for cardiomyocyte survival and regulation of sarcomere length. Plays a role in the pathogenesis of dilated cardiomyopathy via persistent phosphorylation of troponin I (TNNI3). Involved in nerve growth factor (NFG)-induced neurite outgrowth and neuron morphological change independently of its kinase activity, by inhibition of RHOA pathway, activation of CDC42 and cytoskeletal rearrangement. May be involved in presynaptic facilitation by mediating phorbol ester-induced synaptic potentiation. Phosphorylates gamma-aminobutyric acid receptor subunit gamma-2 (GABRG2), which reduces the response of GABA receptors to ethanol and benzodiazepines and may mediate acute tolerance to the intoxicating effects of ethanol. Upon PMA treatment, phosphorylates the capsaicin- and heat-activated cation channel TRPV1, which is required for bradykinin-induced sensitization of the heat response in nociceptive neurons. Is able to form a complex with PDLIM5 and N-type calcium channel, and may enhance channel activities and potentiates fast synaptic transmission by phosphorylating the pore-forming alpha subunit CACNA1B (CaV2.2). In prostate cancer cells, interacts with and phosphorylates STAT3, which increases DNA-binding and transcriptional activity of STAT3 and seems to be essential for prostate cancer cell invasion. Downstream of TLR4, plays an important role in the lipopolysaccharide (LPS)-induced immune response by phosphorylating and activating TICAM2/TRAM, which in turn activates the transcription factor IRF3 and subsequent cytokines production. In differentiating erythroid progenitors, is regulated by EPO and controls the protection against the TNFSF10/TRAIL-mediated apoptosis, via BCL2. May be involved in the regulation of the insulin-induced phosphorylation and activation of AKT1. Phosphorylates NLRP5/MATER and may thereby modulate AKT pathway activation in cumulus cells.
Gene References into Functions
  1. PKCvarepsilon directly modulates the Aurora B-dependent abscission checkpoint by phosphorylating Aurora B at S227. This phosphorylation invokes a switch in Aurora B specificity, with increased phosphorylation of a subset of target substrates, including the CPC subunit Borealin. PMID:28004745
  2. Results indicate an important role of protein kinase C epsilon (PKCepsilon) in autophagy and as a therapeutic target. PMID:29439667
  3. PKC epsilon, activated by DCP-LA, increases elastin and fibulin-5/DANCE in the extracellular space of cultured fibroblasts by the mechanism independent of transcriptional and translational modulation or inhibition of elastolysis. PMID:29590645
  4. The downregulation of mi143 promoted cell proliferation by regulating PKCepsilon in the hepatocellular carcinoma cells. PMID:28765889
  5. These results demonstrate the relevance of hepatic diacylglycerol-induced PKCepsilon activation in the pathogenesis of NAFLD-associated hepatic insulin resistance in humans. PMID:28591572
  6. Data show that protein kinase C epsilon (PKCepsilon) phosphorylates migration and invasion inhibitory protein (MIIP) at Ser303 and promotes its binding to RelA/p65, facilitating colorectal cancer metastasis. PMID:29038521
  7. NF-kappaB signaling thus appears to play a critical role in promoting both castration resistance and enzalutamide resistance in PKC/Twist1 signaling in prostate cancer. PMID:28223364
  8. results imply that an intimate correlation between miR-218-5p and PRKCE/MDR1 axis abnormal expression is a key determinant of gemcitabine tolerance, and suggest a novel miR-218-5p-based clinical intervention target for Gallbladder cancer patients. PMID:28492560
  9. Resistin-associated vascular smooth muscle cell dysfunction and intimal hyperplasia are related to PKCepsilon-dependent Nox activation and ROS generation PMID:27573736
  10. PKCepsilon is a key upstream mediator in resistin-induced inflammation that may interact synergistically with TLR4 to promote NF-kB activation in macrophages. PMID:28286252
  11. protein kinase C-epsilon regulation, phospholipase D1 protects retinal pigment epithelium cells from lipopolysaccharide-induced damage PMID:27793751
  12. we demonstrate that PKCepsilon cooperates with the loss of the tumor suppressor Pten for the development of prostate cancer in a mouse model. Mechanistic analysis revealed that PKCe overexpression and Pten loss individually and synergistically upregulate the production of the chemokine CXCL13, which involves the transcriptional activation of the CXCL13 gene PMID:28402859
  13. These results indicate that PKC promotes synaptogenesis by activating PSD-95 phosphorylation directly through JNK1 and calcium/calmodulin-dependent kinase II and also by inducing expression of PSD-95 and synaptophysin. PMID:27330081
  14. epsilonPKC phosphorylation and its coevolution with ALDH2 play an important role in the regulation and protection of ALDH2 enzyme activity. PMID:28056995
  15. PKCepsilon down-regulation suppresses sorting and the cancer stem-like phenotype of renal cell carcinoma 769P side population cells through the regulation of ABCB1 transporter and the PI3K/Akt, Stat3 and MAPK/ERK pathways that are dependent on the phosphorylation effects. PMID:27037060
  16. PRKCE plays two major roles in cardiac muscle cells: it takes part in regulating cardiac muscle contraction via targeting the sarcomeric proteins, as well as it modulates cardiac cell energy production and metabolism by targeting cardiac mitochondria. (Review) PMID:27312950
  17. PKCepsilon is a key factor for driving the formation of bone metastasis by prostate cancer cells and is a potential therapeutic target for advanced stages of the disease. PMID:26023164
  18. Depletion of PKCepsilon not only enhanced HGF-induced phosphorylation of JNK and paxillin (Ser178) but also prevented c-Met degradation. PMID:25778903
  19. miR-34a regulates blood-tumor barrier (BTB) function by targeting PKCepsilon; after phosphorylation, PKCepsilon is activated and contributes to regulation of the expression of tight junction-related proteins, ultimately altering BTB permeability. PMID:25788289
  20. PKCepsilon-CREB-Nrf2 signalling induces HO-1 in the vascular endothelium and enhances resistance to inflammation and apoptosis. PMID:25883219
  21. PKC-delta activates p38/MAPK, responsible for the inhibition of MMP-2 and -9 secretion, PKC-epsilon activates a pathway made of ERK1/2, mTOR and S6K responsible for the inhibition of NHE1 activity and cell migration. PMID:25372487
  22. HepaCAM may prevent the translocation of PKCepsilon from cytosolic to particulate fractions, resulting in the inhibition of 786-0 cell proliferation. PMID:24515280
  23. Knockdown of PKCepsilon expression inhibited proliferation, induced apoptosis and decreased invasiveness of human glioma cell lines, and suppressed the growth of U87 cell-derived tumors in nude mice. PKCepsilon physically interacts with Stat3. PMID:24888992
  24. PKCepsilon-mediated regulation has a role in protection from loss of chromosome integrity in cells failing to resolve catenation in G2 PMID:25483024
  25. Data suggest that interleukin-32alpha (IL-32alpha) associates with leukemia zinc finger (PLZF) and protein kinase c epsilon (PKCvarepsilon), and then inhibits PLZF sumoylation, resulting in suppression of the transcriptional activity of PLZF. PMID:25178676
  26. IL-32alpha inhibits BCL6 SUMOylation by activating PKCepsilon, resulting in the modulation of BCL6 target genes and cellular functions of BCL6. PMID:25245533
  27. Suggest distinct role of PKCepsilon in controlling cell fate and immune response of monocyte subsets. PMID:25322815
  28. MicroRNA-146a controls Th1-cell differentiation of human CD4-positive T-lymphocytes by targeting PKCepsilon. PMID:25308712
  29. PKC epsilon regulates the interaction between Cx43 and Kir6.1 in the cardiomyocyte mitochondria and this interaction prevents hypoxia induced cell death. PMID:24815185
  30. PKCepsilon activation may have therapeutic efficacy for AD by reducing neurotoxic Abeta accumulation as well as having direct anti-apoptotic and synaptogenic effects PMID:24848988
  31. RNAi silencing of Sp1 and STAT1 in breast cancer cells reduced PKC mRNA and protein expression, as well as PRKCE promoter activity. PMID:24825907
  32. a novel mechanism by which a PKC-Rab5a-Rac1 axis regulates cytoskeleton remodeling and T-cell migration, both of which are central for the adaptive immune response. PMID:24872409
  33. VIP regulates CFTR membrane expression and function in Calu-3 cells by increasing its interaction with NHERF1 and P-ERM in a VPAC1- and PKCepsilon-dependent manner. PMID:24788249
  34. PKCepsilon activation in late passage NP cells may represent a molecular basis for aggrecan availability, as part of an PKCepsilon/ERK/CREB/AP-1-dependent transcriptional program that includes upregulation of both chondrogenic genes and microRNAs PMID:24312401
  35. our results identify a novel regulatory pathway involving the interplay between ZO-1, alpha5-integrin and PKCepsilon in the late stages of mammalian cell division. PMID:23967087
  36. High PRKCE expression is associated with papillary thyroid tumor development. PMID:23457043
  37. Vascular endothelial tight junctions and barrier function are disrupted by 15(S)-hydroxyeicosatetraenoic acid partly via protein kinase C epsilon-mediated zona occludens-1 phosphorylation at threonine 770/772. PMID:24338688
  38. activated in compressive load-cultured nucleus pulposus cells PMID:24166186
  39. MiR-143 specifically targets the 3'-UTR of PRKCE and regulates its expression. PMID:24070896
  40. Data indicate that small molecules that block the oncogenic addiction to PKCepsilon signaling by promoting ATF2 nuclear export, resulting in mitochondrial membrane leakage and melanoma cell death. PMID:23589174
  41. PKC epsilon plays central role in mediating HGF-induced fluctuant ERK-paxillin signaling, probably via the regulation of endosomal degradation of c-Met for the migration of HepG2. PMID:23524339
  42. This study identifies PKCzeta as a novel key upstream regulator of BA-regulated SHP function, revealing the role of Thr-55 phosphorylation in epigenomic regulation of liver metabolism. PMID:23824184
  43. similar to Ser-428/431 (in LKB1(L)), Ser-399 (in LKB1(S)) is a PKCzeta-dependent phosphorylation site essential for nucleocytoplasmic export of LKB1(S) and consequent AMPK activation. PMID:23612973
  44. Upregulation of PKCeta contributes to breast cancer cell growth and targeting either PKCepsilon or PDK1 triggers PKCeta downregulation PMID:23562764
  45. Phosphorylation of serine 779 in fibroblast growth factor receptor 1 and 2 by protein kinase C(epsilon) regulates Ras/mitogen-activated protein kinase signaling and neuronal differentiation. PMID:23564461
  46. Ciliated cell detachment is associated with PKCepsilon autodownregulation in bronchial epithelium. PMID:22712879
  47. Studies indicate that protein kinase C isoform epsilon (PKCepsilon) is differentially regulated in erythrocyte and megakaryocyte progenitors, suggesting an addressing role toward maturation of either lineage. PMID:23266964
  48. MiR-31 directly targets PRKCE and thereby suppresses NF-kappaB activity and induces apoptosis and sensitivity to anti-cancer treatments via down-regulation of BCL2 expression. PMID:23364795
  49. data suggest that platelet generations produced before the acute event retain PKCepsilon-mRNA that is not down-regulated during terminal megakaryocyte differentiation. PMID:23071564
  50. Report metabolic cooperation between the EGFR/PKC-epsilon/NF-kappaB pathway in PKM2 upregulation and tumorigenesis. PMID:23123196

Show More

Hide All

Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane. Cytoplasm, perinuclear region. Nucleus.
Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, PKC subfamily
Tissue Specificity
Expressed in cumulus cells (at protein level).
Database Links

HGNC: 9401

UNIGENE: Hs.580351

KEGG: hsa:5581

STRING: 9606.ENSP00000306124

OMIM: 176975

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1