Recombinant Human Protein delta homolog 1 (DLK1), partial

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
DLK1
Uniprot NO.
Research Area
Neuroscience
Alternative Names
Adipocyte differentiation inhibitor protein; Brevideltin; Delta like 1 homolog; Delta like homolog; Delta like protein; Delta1; DLK 1; DLK; DLK-1; DLK1; DLK1_HUMAN; FA 1; FA1; Fetal antigen 1; pG2; Preadipocyte factor 1; Pref 1; Pref; Pref1; Protein delta homolog 1; Secredeltin; ZOG
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
24-303aa
Target Protein Sequence
AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
partial
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
May have a role in neuroendocrine differentiation.
Gene References into Functions
  1. Data suggest that targeted methylation of MEG3-DMRs (differentially methylated regions) is sufficient to repress DLK1-MEG3 locus and increase beta-cell susceptibility to cytokines; this study provides evidence for role of novel enhancer in regulation of imprinting at DLK1-MEG3 locus in beta-cells of subjects with type 2 diabetes . (MEG3 = MEG3 non-coding RNA; DLK1 = delta-like 1 protein) PMID:30084829
  2. We conclude methylation changes at some CpG sites of MEST and DLK differentially methylated regions in preeclamptic group PMID:29157033
  3. point mutations in DLK1 and KCNK9 at least do not seem to be a common cause of central precocious puberty in girls. PMID:28672280
  4. The expression of piRNAs encoded at DLK1-DIO3 enhances the prognostic potential of small non-coding RNAs specific to this locus in predicting lung cancer patient outcome. PMID:27829231
  5. targeting DLK1 might inhibit the tumor growth via initiating cell differentiation of hepatocellular carcinoma (HCC) cancer stem cell. PMID:27683116
  6. SASH1 acts through NOTCH1 and its inhibitor DLK1 in a three-dimensional model of lumenogenesis involving CEACAM1. PMID:28823832
  7. The data presented in this work suggest that a fine regulation of NOTCH signaling BY DLK1 plays an important role in the control of breast cancer cell proliferation and invasion. PMID:28461338
  8. results demonstrate that miR-129-5p inhibits non-small cell lung cancer stemness and chemoresistance through direct targeting of DLK1 PMID:28619508
  9. A complex defect of DLK1 ( approximately 14-kb deletion and 269-bp duplication) was identified in a family with central precocious puberty. This deletion included the 5' untranslated region and the first exon of DLK1, including the translational start site. Only family members who inherited the defect from their father have precocious puberty, consistent with the known imprinting of DLK1. PMID:28324015
  10. Loss of DLK1 expression is associated with fetal growth retardation complications of pregnancy. PMID:27776119
  11. In neonatal skin, DLK1 exhibited a high degree of monoallelic expression from the paternal allele. PMID:27329732
  12. The study evaluated the roles of extracellular soluble DLK1, comprising six EGF-like domains and juxtamembrane regions, in human pancreatic cancer MIA PaCa-2 cells in vitro and in vivo. Soluble DLK1 exerted antitumor effects not only in cancer cell migration and anchorage-independent cell growth but also in in vivo tumor growth. PMID:27191393
  13. Treatment of mice with recombinant human DLK1 during pregnancy has significant effects on AT of the offspring. This can be associated with counter-regulatory changes in the Notch1 signaling cascade. PMID:26499442
  14. NOTCH1 ligand Delta-like 1 homolog (DLK1) self interacts PMID:28099888
  15. Pref-1 induces insulin synthesis and secretion via two independent pathways PMID:27044861
  16. Data from longitudinal, nested case-control study conducted in rural South Korea suggest that low serum levels of DLK1 (preadipocyte factor 1) may be useful biomarker for identifying women (but not men) at high risk of developing insulin resistance, prediabetes, and type 2 diabetes. PMID:26220259
  17. The appropriate timing of Dll1 expression is critical for its oscillatory expression, pointing to the functional significance of Dll1-mediated oscillatory cell-cell interactions in the segmentation clock. [review] PMID:26818178
  18. Results suggest a potential signalling hierarchy between Delta-like 1 and ephrin-B2 ligands, as neural stem cells adopt the Delta-like 1 phenotype of stem cell maintenance on simultaneous presentation of both signals. PMID:26754526
  19. The results indicate the occurrence of epimutation affecting the IG-DMR and the MEG3-DMR in the two cases, and imply that UPD(14)mat and related (epi)genetic aberrations constitute a rare but important underlying factor for Silver-Russell Syndrome PMID:25351781
  20. Kaplan-Meier analysis indicated that higher DLK1 levels were associated with shorter survival in Hepatocellular carcinoma (HCC) patients. These results suggest that the serum levels of DLK1 may serve as a prognostic biomarker for HCC patients. PMID:26018510
  21. Notch pathway activation in endothelial colony forming cells in vivo via co-implanted stromal cells expressing delta-like 1 promotes vasculogenesis. PMID:25559145
  22. Data show that the median expression of Jagged-1 protein and delta-like 1 protein (Dll-1) was significantly higher in acute myeloid leukemia (AML) blasts than in peripheral blood stem cells (PBSCs). PMID:24844362
  23. DLK1 expression diminishes during differentiation of human U937 cells to macrophages. PMID:26115479
  24. Differentiation was comparatively weighted toward the second peak in Delta1 pre-expanded cells. PMID:23831361
  25. Data show that preadipocyte factor 1 Pref-1 is probably not a major contributor to gestational diabetes mellitus (GDM) pathophysiology but might directly contribute to triglycerides (TG) metabolism, as well as depend on gestational age and renal function. PMID:25461394
  26. These mice show improved glucose tolerance. Taken together, we conclude Pref-1 as a positive regulator of islet beta-cells and insulin production. PMID:25918019
  27. Serum levels of Pref-1 were associated with the amount of alcohol consumed during the past 30 days. PMID:25449367
  28. DLK1 can promote the invasion of lung cancer cells by upregulating MMP9 expression, which depends on Notch signaling PMID:24621612
  29. DLK1, INSL3 and COUP-TFII expression changes during normal development and is linked to different stages of Leydig Cell differentiation. PMID:24908673
  30. the microRNA cluster at the Dlk1-Dio3 locus is upregulated in lung adenocarcinoma PMID:24317514
  31. Pregnancies complicated by gestational diabetes mellitus have decreased fetal pref-1 concentrations compared to normal pregnancies PMID:24518358
  32. In particular, a locus on chromosome 6 comprises a well-known cluster of imprinted genes including the paternally expressed Dlk1, an atypical Notch ligand PMID:24676147
  33. DLK1 interacts with the PHB1-PHB2 complex via its cytoplasmic domain and regulates mitochondrial functions, including mitochondrial membrane potential and production of reactive oxygen species. PMID:24249679
  34. Overall, the data suggest that active expression of the DLK1-DIO3 cluster represents a new biomarker for epigenetic stability of hESCs and indicates the importance of using a proper physiological oxygen level during the derivation and culture of hESCs. PMID:24123616
  35. We found that, while embryonal rhabdomyosarcomas tumors consistently show LOI of the differentially methylated regions at the DLK1-GTL2 locus, alveolar rhabdomyosarcomas tumors have erasure of imprinting (EOI) at this locus. PMID:24173021
  36. the imprinted DLK1-DIO3 locus is regulated by noncoding RNA IPW in an induced pluripotent stem cell model of Prader-Willi syndrome PMID:24816254
  37. These results support a role for microRNAs of DLK1-MEG3 cluster and their epigenetic control by DNA methylation in the pathogenesis of type 2 diabetes mellitus. PMID:24374217
  38. Elevated Pref-1 concentrations in type 2 diabetes mellitus (T2DM) subjects may contribute to impaired adipose tissue differentiation capacity associated with insulin resistance in obese patients with T2DM. PMID:23979788
  39. Pref-1 have differential effects on bone mineral density and strength parameters in adolescent athletes compared with non-athletes PMID:23579340
  40. Dlk1 is a candidate marker for skeletal muscle tumors PMID:23577150
  41. Primary prostatic cancer-associated fibroblasts (CAFs) were isolated and the expression of CAF markers, Dlk1 and SCUBE1 transcripts were characterised. PMID:23136397
  42. Placental Pref-1 expression in SGA fetuses was decreased and associated with postnatal body weight, suggesting a role of Pref-1 in the regulation of postnatal development. PMID:23410724
  43. Paternal methylation aberrations at imprinting control regions of DLK1-GTL2, MEST (PEG1), and ZAC (PLAGL1) and global methylation levels are not associated with idiopathic recurrent spontaneous miscarriages. PMID:23415968
  44. that alterations in Pref-1 are not involved in the ethiopathogenesis of anorexia nervosa but its changes after partial realimentation could be involved in the regulation of adipose tissue expansion after realimentation. PMID:22292722
  45. The mRNA expression of TET2 in CD(3)(+) T cells of myelodysplastic syndrome patients was decreased while the mRNA expression of DLK1 was increased. PMID:22943828
  46. Loss of methylation at the DLK1-MEG3 locus correlates linearly with global loss of DNA methylation in human hepatocellular carcinoma. PMID:23145177
  47. Reviewed are the microRNAs within the DLK1-DIO3 genomic region, their role in controlling tissue homeostasis and in the pathogenesis of some human diseases, mostly cancer, when aberrantly expressed. [review] PMID:22825660
  48. DLK1 mRNA levels are higher in MDS patients and lower in AML patients than in healthy individuals. PMID:22513084
  49. Dlk may regulate the endothelial function in neuroblastic tumors. PMID:15605081
  50. Delta-like protein seems to be a highly sensitive and specific marker for hepatoblastomas. PMID:18236070

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein. Cytoplasm.
Tissue Specificity
Found within the stromal cells in close contact to the vascular structure of placental villi, yolk sac, fetal liver, adrenal cortex and pancreas and in the beta cells of the islets of Langerhans in the adult pancreas. Found also in some forms of neuroendo
Database Links

HGNC: 2907

UNIGENE: Hs.116631

KEGG: hsa:8788

STRING: 9606.ENSP00000340292

OMIM: 176290

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1