Abbreviation
Recombinant Human DLK1 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human DLK1 at 2 μg/mL can bind Anti-DLK1 recombinant antibody (CSB-RA006945MA1HU). The EC50 is 1.598-1.804 ng/mL.②Measured by its binding ability in a functional ELISA. Immobilized Human DLK1 at 2 μg/mL can bind Anti-DLK1 recombinant antibody (CSB-RA006945MA2HU). The EC50 is 1.935-2.143 ng/mL.
Alternative Names
Protein delta homolog 1; DLK-1; pG2; DLK1; DLK
Species
Homo sapiens (Human)
Expression Region
24-303aa
Target Protein Sequence
AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DLK1 at 2 μg/ml can bind Anti-DLK1 recombinant antibody (CSB-RA006945MA1HU). The EC50 is 1.598-1.804 ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DLK1 at 2 μg/ml can bind Anti-DLK1 recombinant antibody (CSB-RA006945MA2HU). The EC50 is 1.935-2.143 ng/mL.
-
The purity of DLK1 was greater than 95% as determined by SEC-HPLC
Description
DLK1 functions as a non-canonical Notch ligand that regulates stem cell maintenance and lineage commitment across multiple tissue contexts, making quantitative assessment of its receptor-binding properties essential for differentiation studies. This mammalian-expressed construct spanning residues 24–303 demonstrates robust antibody recognition with EC50 values of 1.598–1.804 ng/mL and 1.935–2.143 ng/mL in functional ELISA, providing a validated standard for antibody characterization assays and competitive binding experiments that dissect DLK1–Notch interactions. The mammalian expression system preserves native glycosylation patterns critical for proper folding and receptor engagement, supporting its use in stem cell differentiation protocols—including adipogenic, osteogenic, and neuronal lineage studies—where DLK1 activity directly influences fate decisions. With >95% purity and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for cell-based proliferation assays and in vitro models examining DLK1's role in developmental signaling and tumor biology.