Recombinant Human Protein boule-like (BOLL)

CSB-EP854082HUc0

Rate （N/A）
Review （0）

Size:

20ug100ug1mg

US$306

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: N-terminal 6xHis-GST-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

BOLL

Uniprot NO.

Q8N9W6

Research Area

Epigenetics and Nuclear Signaling

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-283aa

Target Protein Sequence

MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY

Mol. Weight

62.8 kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-GST-tagged

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function

Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation.

Gene References into Functions

hypermethylation of DAZL and BOULE promoters in human sperm is associated with human infertility PMID:27358391
Our study demonstrated an oncogenic role of BOLL in CRC despite tumor-specific promoter hypermethylation. PMID:25605553
demonstrate that Boll is also transiently expressed during oogenesis in the fetal mouse ovary, but is simultaneously co-expressed within the same germ cells as Dazl PMID:24086306
Assessing the expression of both CDY1 and BOULE by qualitative RT-PCR is a sensitive and feasible test for predicting the presence of sperm cells in testicular tissue biopsies. PMID:21474125
expression of spermatogenic phenotypes of partial AZFc deletions is independent of the variations in DAZL and BOULE in the Han population PMID:19342699
BOULE may encode a key conserved switch that regulates progression of germ cells through meiosis in men. PMID:12499397
Role in spermatogenesis. Decreased DAZ proteins in spermatogenic failure may be due to germ cell loss. Transcription of BOULE, DAZL, and DAZ not altered in degrees of spermatogenic failure. No increase of DAZL or BOULE found in DAZ deletion. PMID:15066460
Major group of infertile men with meiotic arrest lack BOULE protein and its putative target, CDC25A expression. Spermatogenic failure may arise from factor(s) upstream of BOULE possibly involved in regulating transcription and/or translation of BOULE. PMID:15070965
BOULE coding sequence mutations are not an important factor in the aetiology of azoospermia. PMID:15379971
mutations in BOULE can be eliminated as a major cause of impaired spermatogenesis. PMID:15705409
Among the three BOULE isoforms, B2 might have the major role for meiotic completion. PMID:17114206
CDC25A is subject to translational control by BOLL, which is an evolutionarily conserved mechanism. PMID:19417033
human DAZL (deleted in azoospermia-like) functions in primordial germ-cell formation, whereas closely related genes DAZ and BOULE (also called BOLL) promote later stages of meiosis and development of haploid gametes PMID:19865085

Hide All

Subcellular Location

Cytoplasm.

Protein Families

RRM DAZ family

Tissue Specificity

Testis specific. Not expressed in early embryos, primordial germ cells and spermatogonial cells. First expressed in the cytoplasm of spermatocytes and then persists through meiosis.

Database Links

HGNC: 14273

UNIGENE: Hs.169797

KEGG: hsa:66037

STRING: 9606.ENSP00000314792

OMIM: 606165

Promotions