Recombinant Human Osteocalcin (BGLAP)

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
BGLAP
Uniprot NO.
Alternative Names
Osteocalcin; Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein; BGLAP
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
52-100
Target Protein Sequence
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Gene References into Functions
  1. The results of this study suggest that serum osteocalcin is associated with the onset of puberty in girls. PMID:30089739
  2. The correlation between Mycobacterium avium subsp. paratuberculosis (MAP) infection and elevation of sera ucOC, reduction of active osteocalcin and increased calcium supports MAP infection role in Crohn's disease and complications with osteoporosis. PMID:29638140
  3. The results showed no significant correlation between osteocalcin HindIII gene polymorphism and bone mineral density (BMD) and therefore osteocalcin HindIII gene polymorphism may not have major effects on BMD variation in postmenopausal North Indian women. PMID:30179426
  4. Decreased circulating carboxylated osteocalcin is associated with low-energy bone fractures in children. PMID:29882816
  5. a decrease in serum osteocalcin levels is associated with future development of type 2 diabetes mellitus. PMID:28766135
  6. Findings from the available data indicated an overall significant inverse association between serum osteocalcin and body mass index--{REVIEW} PMID:28822067
  7. relatively lower serum osteocalcin levels were associated with a higher risk of MACE in Chinese men with CAD PMID:28921598
  8. undercarboxylated form of osteocalcin in serum not related significantly to semen parameters or measured hormones in male infertility PMID:28000970
  9. serum level not correlated with gender, race/ethnicity, age, diabetes type, BMI percentile, random C-peptide, glucose, or HbA1c at pediatric diabetes diagnosis; serum level inversely correlated with HbA1c at first office visit following diagnosis PMID:28093839
  10. Serum osteocalcin was directly and independently correlated with circulating uric acid in a population of healthy obese subjects. PMID:28847266
  11. gamma-carboxylation of OCN on Glu17 residue correlates with insulin resistance and subclinical inflammation, suggesting that gamma-carboxylation of OCN negatively regulates its endocrine action PMID:28242268
  12. There were differences in the associations between total osteocalcin and glucose metabolism in Han and Uygur T2DM patients, indicating genetic factors may play a role in modulating OC and glucose metabolism in different ethnic population. PMID:28732499
  13. The study demonstrated that undercarboxylated osteocalcin (ucOC) is related to 25(OH)D and adiponectin concentrations. Both ucOC and 25(OH)D were lower in overweight and obese adolescents. PMID:28443718
  14. Increased advanced glycation end products and protein oxidative damage markers in the course of obesity may contribute to decreased carboxylated osteocalcin serum level. PMID:28841723
  15. Progressive calcification of atherosclerotic plaques is accompanied by insignificant accumulation of calcitonin and osteoprotegerin, whereas the osteocalcin expression significantly increased during calcification. PMID:28429221
  16. Undercarboxylated osteocalcin reflects the reserve capacity of beta-cell function, such as the bolus insulin secretion ability in patients with type 2 diabetes. PMID:27889949
  17. XPS showed that similar amounts of hOC and dhOC were absorbed onto hydroxyapaptite and octacalcium phosphate surfaces, but ToF-SIMS detected some small differences in the amino acid fragment intensities on these surfaces for adsorbed hOC and dhOC. PMID:28521505
  18. Common polymorphism rs1800247 in osteocalcin gene was associated with hypertension and diastolic blood pressure levels. The association of rs1800247 with hypertension was affected by its interaction with HOMA-IR. PMID:27251081
  19. These findings indicate the undercarboxylated form of OC is not implicated in age-related changes in skeletal muscle or adipose tissue mass in older community-dwelling adults. PMID:27604070
  20. Demonstrate a positive association between osteocalcin, a factor known to regulate bone remodelling, with cognitive performance in older non-demented women. PMID:27515675
  21. Common genetic variants of the osteocalcin gene may not be a major contributor to variations in serum osteocalcin or BMD in postmenopausal and elderly Chinese women. PMID:28002816
  22. Several detected relations between OCN and metabolites were strongly linked to renal function, however, a number of associations remained significant after adjustment for renal function. Intermediates of proline catabolism were associated with OCN reflecting the implication in bone metabolism. PMID:28922389
  23. Low serum osteocalcin concentrations are associated with type 2 diabetes. PMID:27061949
  24. Decreased blood concentration of Carboxylated osteocalcin is associated with metabolic complications and inflammation. PMID:27667744
  25. Total and undercarboxylated osteocalcin levels were significantly correlated with insulin secretion and insulin resistance indices, but not adiponectin levels, in pregnant women. PMID:26708046
  26. Osteocalcin and Sex Hormone Binding Globulin Compete on a Specific Binding Site of GPRC6A. PMID:27673554
  27. Osteocalcin plays an essential role for the maturation of mineral species and modulates osteogenic differentiation of mesenchymal stromal cells (MSCs). PMID:28106724
  28. Serum osteocalcin levels in pediatric obstructive sleep apnea hypopnea syndrome patients were significantly lower than normal controls before adenotonsillectomy. PMID:26938749
  29. the relationship between serum osteocalcin and glucose metabolism parameters in liver transplantation recipients, was examined. PMID:26743527
  30. Reduced plasma Osteocalcin levels are associated with cardiovascular and metabolic diseases. PMID:26863345
  31. An overview of osteocalcin progress. PMID:26747614
  32. the BMP-2/Smad1/5/RUNX2 signaling pathway participates in the silicon-mediated induction of COL-1 and osteocalcin synth PMID:27025722
  33. Data indicate that lower osteocalcin was an independent predictor of worse cognitive performance on multivariate analysis. PMID:26406918
  34. A common polymorphism rs1800247 in osteocalcin gene may effect the risk of osteoporosis and fracture and serum osteocalcin levels in Chinese. PMID:26194493
  35. There is an inverse relationship between the visfatin and undercarboxylated osteocalcin in type 2 diabetes patients with diabetic kidney disease. PMID:26922969
  36. This study investigated osteocalcin, metabolic parameters and anthropometric characteristics in normal weight and overweight/obese children. PMID:26772621
  37. Nonalcoholic fatty liver disease negatively associated with right-hip bone mineral density and serum osteocalcin in Korean men. PMID:26636404
  38. The aims of this study were to evaluate OCN and sclerostin levels in subjects who underwent coronary artery bypass graft (CABG) surgery compared with those in normal controls. PMID:26576474
  39. serum level not associated with weight loss or body fat percentage PMID:25963022
  40. Serum osteocalcin levels are inversely correlated with nonalcoholic fatty liver disease in postmenopausal Chinese women with normal blood glucose levels. PMID:26567728
  41. Serum total osteocalcin level is significantly lower in 2 diabetes mellitus patients than controls. PMID:26372899
  42. Elevated serum preptin and decreased osteocalcin concentrations, together with insulin resistance, are associated with obesity and overweight. PMID:25675353
  43. gestational diabetes is not associated with osteocalcin, under-carboxylated osteocalin, osteopontin and leptin and does not correlate with insulin resistance. PMID:25480426
  44. Serum uOC levels in non-dialysis patients with CKD are significantly lower than those in healthy individuals, and uOC is closely associated with subclinical atherosclerosis in CKD patients. PMID:26381729
  45. Endocrine function of osteocalcin and the cell biology events that allow osteocalcin to become a hormone. [review] PMID:25577163
  46. Data indicate that higher osteocalcin (OC) or its undercarboxylated form (ucOC) concentration and ucOC to osteocalcin ratio (OCR) were associated with the risk of coronary calcification in men. PMID:25868823
  47. Data suggest that a low serum osteocalcin level was an independent risk factor for abdominal obesity. PMID:25871789
  48. Correlation between osteocalcin-positive endothelial progenitor cells and spotty calcification in patients with coronary artery disease PMID:25644945
  49. These findings unequivocally document that increased vitamin K intake reduces the uncarboxylated form of OCN PMID:25855755
  50. Serum osteocalcin level was not independently associated with C-IMT in a metabolically healthy Chinese population. PMID:26077201

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Osteocalcin/matrix Gla protein family
Database Links

HGNC: 1043

UNIGENE: Hs.654541

KEGG: hsa:632

STRING: 9606.ENSP00000357255

OMIM: 112260

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1