Abbreviation
Recombinant Human OSM protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human OSM at 2 μg/mL can bind Anti-OSM recombinant antibody (CSB-RA017260MA1HU), the EC50 is 3.048-3.860 ng/mL.
Species
Homo sapiens (Human)
Expression Region
26-221aa
Target Protein Sequence
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human OSM at 2μg/mL can bind Anti-OSM recombinant antibody (CSB-RA017260MA1HU)，the EC50 is 3.048-3.860 ng/mL.
-
OSM Recombinant Monoclonal Antibody (CSB-RA017260MA1HU) captured on Protein A Chip can bind Recombinant Human OSM protein with an affinity constant of 0.59 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description
Oncostatin-M plays a pivotal role in JAK/STAT3 and MAPK signaling cascades that govern immune cell differentiation, inflammatory responses, and tissue remodeling. This recombinant human OSM, spanning residues 26–221 with a C-terminal 6xHis tag, is expressed in mammalian cells to preserve native folding and post-translational modifications critical for receptor engagement. Functional ELISA confirms robust binding activity, with immobilized OSM at 2 μg/mL engaging an anti-OSM recombinant antibody at an EC₅₀ of 3.048–3.860 ng/mL, supporting use as a coating antigen for antibody development, an ELISA positive control, or a reference standard in cytokine detection assays. Endotoxin levels below 1.0 EU/μg minimize LPS-driven artifacts in sensitive immune cell assays such as TF-1 proliferation, STAT3 phosphorylation studies, and macrophage activation experiments, while purity exceeding 95% by SDS-PAGE provides a suitable basis for quantitative signaling pathway analyses and in vivo inflammation models.
