Abbreviation
Recombinant Human OSM protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤10 EU/mg by the LAL method
Activity
Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is ≤ 2 ng/mL.
Alternative Names
Oncostatin-M; OSM
Species
Homo sapiens (Human)
Expression Region
26-221aa
Target Protein Sequence
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
Tag free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
Oncostatin-M drives pleiotropic signaling through the gp130 receptor complex, regulating hematopoietic cell proliferation, hepatocyte acute-phase responses, and inflammatory cascades that intersect with both regenerative and pathological processes. This preparation demonstrates robust bioactivity in TF-1 cell proliferation assays with an ED50 ≤ 2 ng/mL, providing quantitative evidence that supports dose-response studies in JAK/STAT and MAPK pathway activation experiments, as well as functional assays examining cytokine-driven differentiation or survival in primary hematopoietic cultures. Spanning the complete mature protein sequence (aa 26–221) and produced in mammalian cells to preserve native glycosylation, the material meets the quality thresholds commonly required for antibody development workflows, including use as an immunogen or ELISA coating antigen. Endotoxin levels ≤10 EU/mg and purity >95% by SDS-PAGE together minimize LPS-driven artifacts in immune cell assays where OSM-specific responses must be distinguished from innate activation.
