Recombinant Human Oncostatin-M (OSM) (Active)

In Stock
Code: CSB-MP017260HU-WD
Size:
10ug
10ug50ug1mg
US$Inquiry
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: Tag free
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human OSM protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤10 EU/mg by the LAL method
Activity
Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is ≤ 2 ng/mL.
Target Names
OSM
Uniprot NO.
Alternative Names
Oncostatin-M; OSM
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
26-221aa
Target Protein Sequence
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.0 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Oncostatin-M drives pleiotropic signaling through the gp130 receptor complex, regulating hematopoietic cell proliferation, hepatocyte acute-phase responses, and inflammatory cascades that intersect with both regenerative and pathological processes. This preparation demonstrates robust bioactivity in TF-1 cell proliferation assays with an ED50 ≤ 2 ng/mL, providing quantitative evidence that supports dose-response studies in JAK/STAT and MAPK pathway activation experiments, as well as functional assays examining cytokine-driven differentiation or survival in primary hematopoietic cultures. Spanning the complete mature protein sequence (aa 26–221) and produced in mammalian cells to preserve native glycosylation, the material meets the quality thresholds commonly required for antibody development workflows, including use as an immunogen or ELISA coating antigen. Endotoxin levels ≤10 EU/mg and purity >95% by SDS-PAGE together minimize LPS-driven artifacts in immune cell assays where OSM-specific responses must be distinguished from innate activation.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIFR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.
Gene References into Functions
  1. The mechanism of prostaglandin E2-induced transcriptional up-regulation of Oncostatin-M by CREB and Sp1 has been described. PMID:29269396
  2. OSM [oncostatin M]might be involved in the invasiveness of extravillous trophoblasts under hypoxia conditions via increasing MMP-2 and MMP-9 enzymatic activities through STAT3 signaling. Increased MMP-9 activity by OSM seems to be more important in primary trophoblasts. PMID:30091322
  3. IL6 family cytokine oncostatin-M (OSM) induced a switch to the EMT phenotype and protected cells from targeted drug-induced apoptosis in OSM receptors (OSMRs)/JAK1/STAT3-dependent manner PMID:28729401
  4. Oncostatin M induces RIG-I and MDA5 expression and enhances the double-stranded RNA response in fibroblasts. PMID:28560754
  5. The IL-6-type cytokine oncostatin M (OSM) indeed induces cellular properties associated with tumorigenesis and disease progression in non-transformed human prostate epithelial cells, including morphological changes, epithelial-to-mesenchymal transition (EMT), enhanced migration and pro-invasive growth patterns. PMID:29526757
  6. downregulation of miR-20a-5p is caused by promoter hypermethylation. MiR-20a-5p could also suppress the production of IL-17 by targeting OSM and CCL1 production in CD4(+) T cells in patients with active VKH. PMID:28972028
  7. our findings suggested that OSM suppresses SLUG expression and tumor metastasis of lung adenocarcinoma cells through inducing the inhibitory effect of the STAT1-dependent pathway and suppressing the activating effect of STAT3-dependent signaling PMID:27486982
  8. Genistein (a specific Tyr phosphorylation inhibitor) leads to the interaction of CHOP (C/EBP Homologous Protein) with C/EBP-beta, thus negatively regulating it. Knockdown of C/EBP-beta also leads to inhibition of PMA-mediated OSM induction. PMID:27676154
  9. Data provide evidence that OSM regulates an epithelial-mesenchymal transition and cancer stem cell plasticity program that promotes tumorigenic properties in pancreatic cells. PMID:28053127
  10. OSM-induced plasticity was Signal Transducer and Activator of Transcription 3 (STAT3)-dependent, and also required a novel intersection with transforming growth factor-beta (TGF-beta)/SMAD signaling. Removal of OSM or inhibition of STAT3 or SMAD3 resulted in a marked reversion to a non-invasive, epithelial phenotype. PMID:28288136
  11. Neutrophils are a major source of OSM-producing cells in patients with chronic rhinosinusitis and severe asthma. PMID:27993536
  12. OSM and OSMR are highly expressed in inflammatory bowel disease intestinal mucosa compared to control mucosa. OSM promotes inflammatory behavior in human intestinal stroma. PMID:28368383
  13. Study showed that in atrial fibrillation (AF) with thrombus, the atrial tissue infiltration of M1 macrophages increased significantly; the OSM expression was also found to increase simultaneously; downstream tissue factor (TF) increased and tissue factor pathway inhibitors (TFPI)decreased, leading to an imbalance between TF and TFPI eventually. OSM might be related to thrombosis in patients with AF mediated by TF and TFPI PMID:28471981
  14. a novel STAT3/SMAD3-signaling axis is required for OSM-mediated senescence. PMID:27892764
  15. This result demonstrates that HPV16 oncoproteins upregulate oncostatin M and play an important role to promote oral squamous cell carcinoma development PMID:27349249
  16. The identification of the OSM inflammatory pathway as an important mediator of epithelial mesenchymal transition in triple-negative breast cancer (TNBC) may provide a novel potential opportunity to improve therapeutic strategies. PMID:28106823
  17. Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology. PMID:26198770
  18. Oncostatin M can regulate airway smooth muscle responses alone or in synergy with IL-17A. PMID:25849622
  19. we demonstrated that recombinant human OSM (rhOSM) promoted tumor angiogenesis in EC cell lines by activating STAT3 (signal transducer and activator of transcription 3) and enhanced both cell migration and cell inva PMID:25954856
  20. OSM expression in osteoblasts increases in response to Osteopontin-induced inflammation in vitro. PMID:26304992
  21. Data suggest that OSM promotes osteoblastic differentiation of vascular smooth muscle cells through JAK3/STAT3 pathway and may contribute to the development of atherosclerotic calcification. PMID:25735629
  22. administration of Fstl1 induced airway remodeling and increased OSM, whereas administration of an anti-OSM Ab blocked the effect of Fstl1 on inducing airway remodeling, eosinophilic airway inflammation PMID:26355153
  23. OSM promotes mucosal epithelial barrier dysfunction, and its expression is increased in patients with eosinophilic mucosal disease. PMID:25840724
  24. Oncostatin M regulates neuronal function and confers neuroprotectin in an animal model of ischemic stroke. PMID:26311783
  25. In patients with diabetes, bone marrow plasma OSM levels were higher and correlated with the bone marrow to peripheral blood stem cell ratio. PMID:25804939
  26. OSM promotes STAT3-dependent intestinal epithelial cell proliferation and wound healing in vitro. PMID:24710357
  27. Autocrine activation of STAT3 in MCF-7 cells ectopically expressing OSM-induced cellular scattering. PMID:25252914
  28. oncostatin M is a cytokine possessing vigorous antiviral and immunostimulatory properties which is released by APC upon interaction with CD40L present on activated CD4+ T cells. PMID:24418171
  29. Data indicate that pro-inflammatory cytokines such as IL6 or OSM could activate pathways associated with prostate cancer progression and synergize with cell-autonomous oncogenic events to promote aggressive malignancy. PMID:23867565
  30. OSM may promote a clinically relevant EMT/CSC-like phenotype in human breast cancer via a PI3K-dependent mechanism PMID:23584474
  31. white adipose tissue macrophages are a source of OSM and OSM levels are significantly induced in obesity/type 2 diabetes. OSM produced from immune cells in WAT may act in a paracrine manner on adipocytes to promote inflammation in adipose tissue. PMID:24297795
  32. data suggest that increased serum OSM levels are associated with the coronary stenosis score and that circulating levels of this chemokine may reflect the extent of coronary atherosclerosis PMID:24600984
  33. TGFBI and periostin, extracellular matrix proteins implicated in tumorigenesis and metastasis, were identified as oncostatin M-induced secreted proteins in mesenchymal stem cells. PMID:23735324
  34. Oncostatin M is a FIP1L1/PDGFRA-dependent mediator of cytokine production in chronic eosinophilic leukemia. PMID:23621172
  35. These data show that OSM and IL-1beta are not only a biological characteristic signature of hypertensive leg ulcer, but these cytokines reflect a specific inflammatory state, directly involved in the pathogenesis. PMID:23313749
  36. OSM induced proliferation of Ewing sarcoma cell lines. PMID:22982441
  37. Data suggest that OSM enhances invasion activities of extravillous trophoblasts during placentation through increased enzyme activity of MMP-2 (primarily) and MMP-9 (to some extent). PMID:22931588
  38. A unique loop structure in oncostatin M determines binding affinity toward oncostatin M receptor and leukemia inhibitory factor receptor. PMID:22829597
  39. Oncostatin M signaling may cause suppression of estrogen receptor-alpha and disease progression i breast cancer. PMID:22267707
  40. Oncostatin M (OSM), a cytokine of the IL-6 family, was identified as a major coupling factor produced by activated circulating CD14+ or bone marrow CD11b+ monocytes/macrophages. PMID:22267310
  41. Oncostatin M (OSM) is a major mediator of cardiomyocyte dedifferentiation and remodeling during acute myocardial infarction (MI) and in chronic dilated cardiomyopathy (DCM). PMID:22056139
  42. JAK2 V617F-mediated up-regulation of OSM may contribute to fibrosis, neoangiogenesis, and the cytokine storm observed in myeloproliferative neoplasms. PMID:22051730
  43. c-MYC is an important molecular switch that alters the cellular response to OSM-mediated signaling from tumor suppressive to tumor promoting. PMID:21975934
  44. A possible interaction between IL-6, OSM, u-PA and VEGF in prostate cancer was investigated. PMID:21965736
  45. This report uses an in vitro model with human umbilical vein endothelial cells and isolated human neutrophils to examine the effects of two locally derived cytokines, granulocyte-macrophage colony-stimulating factor and G-CSF, on oncostatin M expression. PMID:21775705
  46. OSM is expressed in atherosclerotic lesions and may contribute to the progression of atherosclerosis by promoting SMC proliferation, migration and extracellular matrix protein synthesis through the STAT pathway PMID:21376322
  47. Taken together, our data show that KIT D816V promotes expression of OSM through activation of STAT5. PMID:21457934
  48. The purpose of this study was to investigate the possible suppressive or stimulatory role of OSM in the ovarian cancer model of SKOV3 cells, as well as the involvement of the ERK1/2, p38 and STAT3 signaling pathways. PMID:21399864
  49. promotes STAT3 activation, VEGF production, and invasion in osteosarcoma cell lines PMID:21481226
  50. a cytokine-triggered regulatory network for PCSK9 expression that is linked to JAKs and the ERK signaling pathway PMID:21196532

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
LIF/OSM family
Database Links

HGNC: 8506

UNIGENE: Hs.248156

KEGG: hsa:5008

STRING: 9606.ENSP00000215781

OMIM: 165095

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products