Home
Product
Protein
Recombinant Proteins
Recombinant Human Non-secretory ribonuclease (RNASE2)

Recombinant Human Non-secretory ribonuclease (RNASE2)

CSB-EP019794HU

Rate （N/A）
Review （0）

Size:

20ug100ug1mg(1mg*1 or 500ug*2)

US$224

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: N-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

RNASE2

Uniprot NO.

P10153

Research Area

Immunology

Alternative Names

Eosinophil-derived neurotoxinRNase UpI-2Ribonuclease 2 ;RNase 2Ribonuclease US

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

28-161aa

Target Protein Sequence

KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII

Mol. Weight

19.5kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

The production of the recombinant Human RNASE2 protein begins with the creation of the recombinant plasmid, which is synthesized by inserting the gene encoding the Human RNASE2 protein (28-161aa) into a plasmid vector. The recombinant plasmid is introduced into e.coli cells. e.coli cells that can survive in the presence of a specific antibiotic are selected and then cultured under conditions conducive to the expression of the gene of interest. The protein is equipped with a N-terminal 6xHis tag. Following expression, the recombinant RNASE2 protein is isolated and purified from the cell lysate using affinity purification. Denaturing SDS-PAGE is then employed to resolve the resulting recombinant Human RNASE2 protein, demonstrating a purity exceeding 90%.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function

This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities.

Gene References into Functions

In healthy children, 95th Percentile values ranged from 1519 mg/kg at 0 months to 54.4 mg/kg at 144 months for fecal calprotectin (fCP) and from 9.9 mg/kg at 0 months to 0.2 mg/kg at 144 months for fecal eosinophil-derived neurotoxin (fEDN). There was a significant association between age and fCP concentrations and age and fEDN concentrations and a significant association between fEDN and fCP. PMID:28169973
EDN serum level could be considered a candidate molecule as a clinical biomarker for evaluating atopic dermatitis activity and a predictor of relapse PMID:28866306
Serum EDN level may be a useful marker for monitoring persistent airflow limitation in adult patients with asthma who had positive results for house-dust-specific IgE antibodies. PMID:26534742
increased in feces after the ingestion of enterocolitis-causative foods PMID:24890227
RNASE2 gene expression was differentially expressed in rheumatoid arthritis patients considering a sequence polymorphism. PMID:25221852
The antimicrobial protein, RNase 2 exhibits antiviral against respiratory syncytial virus. PMID:9826755
findings show substantial amounts of EPX/EDN localise in an extra-granular, low equilibrium density compartment of eosinophils PMID:23053729
A higher level of serum EDN was found specifically in patients with ALS, indicating that EDN may participate in the pathophysiology of Amyotrophic lateral sclerosis. PMID:23533305
Eosinophil protein X in urine from asymptomatic neonates is a biomarker significantly associated with later development of allergic sensitization, nasal eosinophilia, and eczema during the first 6 years of life PMID:21680952
atomic resolution structure PMID:11876642
crystal structure of a post-translationally modified form of eosinophil-derived neurotoxin (EDN) with four extra residues on its N terminus ((-4)EDN) has been solved and refined at atomic resolution (1 A) PMID:11916383
EDN and ECP are paralogs in human and Old World monkeys. PMID:11959927
evidence for glycosylphosphatidylinositol (GPI)-anchored neurotoxin on granulocytes PMID:12606041
data suggest that peripheral blood eosinophils from subjects with untreated asthma have increased inflammatory capacity, as reflected by greater intracellular concentrations of EDN PMID:15356558
Results reveal the dendritic cell-activating activity of eosinophil-derived neurotoxin and suggest that it is a likely participant of inflammatory and immune responses--an endogenous multifunctional immune alarmin. PMID:15528350
Results describe the crystal structure of placental ribonuclease inhibitor in complex with eosinophil-derived neurotoxin, and a mutational analysis based on this structure. PMID:15755456
May possibly be associated with the development of tropical pulmonary eosinophilia. PMID:16014847
Elevated glycosylated form of EDN in urine is associated with ovarian cancer PMID:16428483
EGO is a novel ncRNA gene expressed during eosinophil development and is necessary for normal MBP and EDN transcript expression. PMID:17351112
Data show that uEPX/c levels did not correlate with established markers of asthma severity and eosinophilic airway inflammation in atopic asthmatic children. PMID:17641730
MAZ and Sp1 play important roles on the transcriptional activation of the human edn promoter through specific binding to a 34-nt segment present in representative primate eosinophil rnase promoters. PMID:17927842
Urinary concentrations of eosinophil-derived neurotoxin in patients with atopic dermatitis show a significant positive correlation with disease severity. PMID:17965582
EDN can activate myeloid DCs by triggering the Toll-like receptor (TLR)2-myeloid differentiation factor 88 signaling pathway PMID:18195069
In three continental population groups (Asia, Europe, Africa), the angiogenin and RNase 2 genes appear to exhibit markedly less genetic heterogeneity with regard to T195C and A238G (ANG) and C425A (RNASE2) SNPs. PMID:18636464
No variation in genes encoding eosinophil-derived neurotoxin for Atopic dermatitis pathogenesis in this German cohort. PMID:19014520
the roles of the six discrete segments in transcription regulation were investigated and the -350/-329 region (ednR2) was shown to be involved in the regulation of edn expression PMID:19115260
ECP and EDN disrupt skin integrity and cause inflammation PMID:19717523