Recombinant Human Non-secretory ribonuclease (RNASE2)

Code: CSB-MP019794HU
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$396
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal hFc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
RNASE2
Uniprot NO.
Research Area
Immunology
Alternative Names
(Eosinophil-derived neurotoxin)(RNase UpI-2)(Ribonuclease 2)(RNase 2)(Ribonuclease US)
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
28-161aa
Target Protein Sequence
KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities.
Gene References into Functions
  1. In healthy children, 95th Percentile values ranged from 1519 mg/kg at 0 months to 54.4 mg/kg at 144 months for fecal calprotectin (fCP) and from 9.9 mg/kg at 0 months to 0.2 mg/kg at 144 months for fecal eosinophil-derived neurotoxin (fEDN). There was a significant association between age and fCP concentrations and age and fEDN concentrations and a significant association between fEDN and fCP. PMID:28169973
  2. EDN serum level could be considered a candidate molecule as a clinical biomarker for evaluating atopic dermatitis activity and a predictor of relapse PMID:28866306
  3. Serum EDN level may be a useful marker for monitoring persistent airflow limitation in adult patients with asthma who had positive results for house-dust-specific IgE antibodies. PMID:26534742
  4. increased in feces after the ingestion of enterocolitis-causative foods PMID:24890227
  5. RNASE2 gene expression was differentially expressed in rheumatoid arthritis patients considering a sequence polymorphism. PMID:25221852
  6. The antimicrobial protein, RNase 2 exhibits antiviral against respiratory syncytial virus. PMID:9826755
  7. findings show substantial amounts of EPX/EDN localise in an extra-granular, low equilibrium density compartment of eosinophils PMID:23053729
  8. A higher level of serum EDN was found specifically in patients with ALS, indicating that EDN may participate in the pathophysiology of Amyotrophic lateral sclerosis. PMID:23533305
  9. Eosinophil protein X in urine from asymptomatic neonates is a biomarker significantly associated with later development of allergic sensitization, nasal eosinophilia, and eczema during the first 6 years of life PMID:21680952
  10. atomic resolution structure PMID:11876642
  11. crystal structure of a post-translationally modified form of eosinophil-derived neurotoxin (EDN) with four extra residues on its N terminus ((-4)EDN) has been solved and refined at atomic resolution (1 A) PMID:11916383
  12. EDN and ECP are paralogs in human and Old World monkeys. PMID:11959927
  13. evidence for glycosylphosphatidylinositol (GPI)-anchored neurotoxin on granulocytes PMID:12606041
  14. data suggest that peripheral blood eosinophils from subjects with untreated asthma have increased inflammatory capacity, as reflected by greater intracellular concentrations of EDN PMID:15356558
  15. Results reveal the dendritic cell-activating activity of eosinophil-derived neurotoxin and suggest that it is a likely participant of inflammatory and immune responses--an endogenous multifunctional immune alarmin. PMID:15528350
  16. Results describe the crystal structure of placental ribonuclease inhibitor in complex with eosinophil-derived neurotoxin, and a mutational analysis based on this structure. PMID:15755456
  17. May possibly be associated with the development of tropical pulmonary eosinophilia. PMID:16014847
  18. Elevated glycosylated form of EDN in urine is associated with ovarian cancer PMID:16428483
  19. EGO is a novel ncRNA gene expressed during eosinophil development and is necessary for normal MBP and EDN transcript expression. PMID:17351112
  20. Data show that uEPX/c levels did not correlate with established markers of asthma severity and eosinophilic airway inflammation in atopic asthmatic children. PMID:17641730
  21. MAZ and Sp1 play important roles on the transcriptional activation of the human edn promoter through specific binding to a 34-nt segment present in representative primate eosinophil rnase promoters. PMID:17927842
  22. Urinary concentrations of eosinophil-derived neurotoxin in patients with atopic dermatitis show a significant positive correlation with disease severity. PMID:17965582
  23. EDN can activate myeloid DCs by triggering the Toll-like receptor (TLR)2-myeloid differentiation factor 88 signaling pathway PMID:18195069
  24. In three continental population groups (Asia, Europe, Africa), the angiogenin and RNase 2 genes appear to exhibit markedly less genetic heterogeneity with regard to T195C and A238G (ANG) and C425A (RNASE2) SNPs. PMID:18636464
  25. No variation in genes encoding eosinophil-derived neurotoxin for Atopic dermatitis pathogenesis in this German cohort. PMID:19014520
  26. the roles of the six discrete segments in transcription regulation were investigated and the -350/-329 region (ednR2) was shown to be involved in the regulation of edn expression PMID:19115260
  27. ECP and EDN disrupt skin integrity and cause inflammation PMID:19717523

Show More

Hide All

Subcellular Location
Lysosome. Cytoplasmic granule. Note=Matrix of eosinophil's large specific granule.
Protein Families
Pancreatic ribonuclease family
Tissue Specificity
Liver, lung, spleen, leukocytes and body fluids.
Database Links

HGNC: 10045

UNIGENE: Hs.728

KEGG: hsa:6036

STRING: 9606.ENSP00000303276

OMIM: 131410

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products