Abbreviation
Recombinant Human CD33 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 μg/ml can bind Anti-CD33 rabbit monoclonal antibody, the EC50 of human CD33 protein is 4.289- 5.312 ng/ml.
Alternative Names
CD33; SIGLEC3; Myeloid cell surface antigen CD33; Sialic acid-binding Ig-like lectin 3; Siglec-3; gp67; CD antigen CD33
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
18-259aa
Target Protein Sequence
DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
CD33 (Siglec-3) is a critical myeloid lineage receptor exploited in antibody–drug conjugate strategies for acute myeloid leukemia, making high-quality recombinant protein essential for therapeutic antibody development. This construct covers the extracellular domain (aa 18–259), encompassing both the V-set and C2-set immunoglobulin-like domains responsible for sialic acid binding and antibody recognition, and is expressed in mammalian cells to preserve native glycosylation and conformational integrity. Functional ELISA confirms robust binding activity, with an EC50 of 4.289–5.312 ng/mL against an anti-CD33 monoclonal antibody, supporting use in epitope mapping, competitive blocking antibody screening, and affinity characterization by SPR or BLI. The C-terminal hFc1-Myc tag facilitates oriented immobilization in binding assays, while purity exceeding 95% and endotoxin levels below 1.0 EU/μg satisfy the criteria typical for cell-based functional studies and drug discovery screening campaigns.