Abbreviation
Recombinant Human CD14 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD14 at 2 μg/mL on an Nickel Coated plate can bind Anti-CD14 recombinant antibody (CSB-RA004879MA1HU). The EC50 is 2.148-2.447 ng/mL.
Alternative Names
Monocyte differentiation antigen CD14; My23 antigen; Myeloid cell-specific leucine-rich glycoprotein; CD14
Species
Homo sapiens (Human)
Expression Region
20-344aa
Target Protein Sequence
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSM
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD14 at 2 μg/ml on an Nickel Coated plate can bind Anti-CD14 recombinant antibody (CSB-RA004879MA1HU). The EC50 is 2.148-2.447 ng/mL.
Description
CD14 serves as the primary pattern recognition receptor for bacterial lipopolysaccharide complexes, making it a critical target for investigating innate immune activation and sepsis pathogenesis. This mammalian-expressed construct spanning residues 20–344 captures the complete extracellular leucine-rich repeat domain responsible for LPS binding, and mammalian post-translational machinery ensures the native glycosylation patterns essential for physiological receptor conformation. Functional ELISA validation demonstrates specific antibody binding with an EC50 of 2.148–2.447 ng/mL, confirming that epitopes remain accessible and properly folded—this quantitative binding profile supports use in therapeutic antibody epitope mapping, competitive inhibition screening to identify blocking candidates, and as a positive control in receptor-ligand interaction assays conducted by ELISA, SPR, or BLI. The protein meets quality thresholds commonly required for antibody development workflows, with >95% purity by SDS-PAGE and endotoxin levels below 1.0 EU/μg.
