Recombinant Human Membrane primary amine oxidase (AOC3), partial

Product Details

Abbreviation
AOC3
Purity
>85% (SDS-PAGE)
Target Names
AOC3
Uniprot NO.
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
27-763
Target Protein Sequence
GRGGDGGEPSQLPHCPSVSPSAQPWTHPGQSQLFADLSREELTAVMRFLTQRLGPGLVDA AQARPSDNCVFSVELQLPPKAAALAHLDRGSPPPAREALAIVFFGRQPQPNVSELVVGPL PHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDIDQMIFNRELPQASGLLHHCCFYKHRGR NLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFY QGRYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSWSLKSPVPPGPAPPLQFYPQGPRFSVQ GSRVASSLWTFSFGLGAFSGPRIFDVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVD GGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSD LYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFYATGYISSAFLFGATGK YGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTR KLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFS WERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFINNETIAGKDLVAWVTAGFLHIP HAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQAA ACAPDLPAFSHGGFSHN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Partial
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Cell adhesion protein that participates in lymphocyte extravasation and recirculation by mediating the binding of lymphocytes to peripheral lymph node vascular endothelial cells in an L-selectin-independent fashion. Has semicarbazide-sensitive (SSAO) monoamine oxidase activity. May play a role in adipogenesis.
Gene References into Functions
  1. The study showed that serum VAP-1 level increased with an increasing severity of obstruction in patients with stable COPD. This increase was associated with a reduced quality of life and increased severity of hypoxia. PMID:29229088
  2. VAP-1 expression is increased in primary sclerosing cholangitis, facilitates adhesion of gut-tropic lymphocytes to liver endothelium in a substrate-dependent manner, and elevated levels of its circulating form predict clinical outcome in patients. PMID:28428344
  3. immunohistochemistry revealed that VAP-1 localized to endothelial cells of intra-plaque neovessels in carotid endarterectomy samples from patients with recent ischemic symptoms PMID:27731409
  4. Adipose tissue SSAO activity did not vary according to anatomical location and/or metabolic status in severely obese women. PMID:27766585
  5. Correlation among soluble receptors for advanced glycation end-products, soluble vascular adhesion protein-1/semicarbazide-sensitive amine oxidase (sVAP-1) and cardiometabolic risk markers in apparently healthy adolescents: a cross-sectional study PMID:27300745
  6. This study showed that the oxidase activity of AOC3 contributes to the development of lung fibrosis mainly by regulating the accumulation of pathogenic leukocyte subtypes, which drive the fibrotic response. PMID:28251930
  7. The mechanism of the Siglec-9 and AOC3 interaction PMID:27893774
  8. psoriatic patients with the dominant AT1R-A1166C polymorphism had significantly higher serum levels of VAP-1 and MDA but lower total bilirubine, uric acid, ARE, SOD and CAT activities compared to the corresponding control group PMID:26395033
  9. These findings suggest that vaspin and VAP-1 may play a role in the pathogenesis of psoriasis and can be used as markers of the disease PMID:25279492
  10. Our results show that colorectal myofibroblasts, as defined by the expression of AOC3, NKX2-3, and other markers, are a distinctly different cell type from TGFbeta-activated fibroblasts PMID:27036009
  11. In this article, we will review the general characteristics and biological functions of VAP-1, focusing on its important role as a prognostic biomarker in human pathologies. [review] PMID:26287391
  12. serum VAP-1 can predict ESRD and is a useful biomarker to improve risk stratification in type 2 diabetic subjects. PMID:26845338
  13. It stimulates amyloid beta proteins on the vascular walls, and is contributing to cerebral amyloid angiopathies and Alzheimer disease. PMID:25457560
  14. Higher serum VAP-1 and Chronic kidney disease can independently predict future development of cancers in type II diabetic subjects PMID:24781952
  15. Complexes of human ORP2 and VAPs at endoplasmic reticulum-lipid droplet interfaces regulate the hydrolysis of triglycerides and lipid droplet turnover. PMID:25420878
  16. these results link the amine oxidase activity of VAP-1 with hepatic inflammation and fibrosis and suggest that targeting VAP-1 has therapeutic potential for NAFLD and other chronic fibrotic liver diseases. PMID:25562318
  17. the semicarbazide-sensitive amine oxidase activity of VAP-1 modifies hepatic glucose homeostasis and may contribute to patterns of GLUT expression in chronic disease. PMID:25342050
  18. This study demonstrated that low serum VAP-1 levels are associated with poor prognosis in gastric cancer patients. PMID:24903765
  19. Serum VAP-1 predicts mortality independently and improves risk stratification in colorectal cancer subjects. PMID:24211727
  20. SSAO expression in endothelial cells increases oxygen-glucose-deprivation-associated cell damage. It mediates some tissue damage during the reoxygenation process by oxidizing its known enzymatic substrate, methylamine. PMID:24503888
  21. We concluded that VAP-1, elevated in patients on Peritoneal Dialysis, was predominantly dependent on residual kidney function and glucose level, factors both linked to endothelial damage and cardiovascular complications. PMID:24379274
  22. VAP-1 elevations in heart transplant recipients were predominantly dependent on left ventricular diameter and use of tacrolimus PMID:23769096
  23. Data suggest that subjects with diabetic retinopathy have higher serum levels of soluble VAP1 than subjects with non-angiogenic ocular diseases (i.e., epiretinal membrane [ERM], idiopathic macular hole [MH], age-related macular degeneration [AMD]). PMID:23062326
  24. Data suggest that the down-regulation of both the expression and enzymatic activity of VAP-1 may result from a dominant-negative effect caused by heterodimerization between VAP-1 and alternatively spliced VAP-1Delta3. PMID:23349812
  25. In psoriatic patients, VAP-1 elevation correlated with elevation of Lp (a). This may be responsible for a higher prevalence of cardiovascular accidents in psoriatic patients. PMID:22753196
  26. The pathogenetic link between the increase in SSAO activity and severity of neurological deficitin ischemic stroke patients was shown. PMID:23120772
  27. high vascular SSAO/VAP-1 levels in human hippocampus may contribute to vascular degeneration PMID:22714978
  28. Protein level of sVAP-1 was increased and correlated with HEL in the vitreous fluid of patients with PDR. PMID:22618595
  29. The immunolocalization of VAP-1 varied in the histopathology of the conjunctiva, involving the pathology of inflammatory conjunctival disorders. PMID:22354146
  30. We found increased VAP-1 activity and anchor protein syndecan-1 content in critically ill patients with septic shock PMID:22150439
  31. Plasma VAP-1/SSAO activity is increased in intracranial hemorrhage and predicts neurological outcome, suggesting a possible contribution of the soluble protein in secondary brain damage. PMID:22133888
  32. This review examines the biological functions of VAP-1, especially the role that this molecule might play in the establishment and progression of chronic liver disease. PMID:21512782
  33. using an endothelial cell model, a description for the first time the involvement of the leucocyte-adhesion activity of SSAO/VAP-1 in the Abeta (amyloid beta-peptide)-mediated pro-inflammatory effect PMID:21819380
  34. The Siglec-9 peptide binding to the enzymatic groove of VAP-1 can be used for imaging conditions, such as inflammation and cancer. PMID:21821708
  35. These remarks suggest that MAO-A and SSAO may play an important role in vascular tissue as well as in the vascular pathophysiology of type 2 diabetes. PMID:21114364
  36. Met211 and Leu469 were shown to be key residues for substrate specificity. PMID:21585208
  37. Serum VAP-1 can predict 10-year all-cause mortality, cardiovascular mortality, and cancer mortality independently in type 2 diabetic subjects. PMID:21282368
  38. The structure of VAP-1 was refined to a resolution of 2.9A. PMID:21139198
  39. A novel combination of surface molecules, including VAP-1 and CX(3)CL1 promotes the recruitment of CD16(+) monocytes to the liver, allowing them to localize at sites of chronic inflammation and fibrosis. PMID:20512991
  40. The SSAO activity in the serum of patients with type 2 diabetes is higher when compared with control group and may be a useful marker for diabetes. PMID:20063021
  41. immunohistochemistry reveals constitutive expression of VAP-1 in human ocular tissues. PMID:19761765
  42. Inflammation of the dental pulp was accompanied by a significant decrease in MAO labeling, MAO B (but not MAO A) activity and the increase in SSAO activity. PMID:19789505
  43. VAP-1 is expressed on hepatic sinusoidal endothelial cells in vitro and supports adhesion and transmigration of lymphocytes across these cells under physiological shear stress. PMID:12097405
  44. Data show that increases in vascular adhesion protein-1 (VAP-1) due to absolute or relative insulin deficiency may be directly involved in the pathogenesis of diabetic angiopathy. PMID:12466139
  45. normal mice and human lungs revealed vascular adhesion protein-1 expression in the endothelium of large and mid-sized pulmonary vessels PMID:12700900
  46. may convert endogenous amines, like methylamine, to vasoactive metabolites. PMID:14715500
  47. the oxidase activity of VAP-1 controls PMN exit from the blood during the relatively poorly understood transmigration step PMID:14726375
  48. Semicarbazide-sensitive amine oxidase is a source of oxidative stress in diseased human skeletal muscle; it contributes to oxidative stress-induced damage in various inflammatory and other myopathies. PMID:14755492
  49. VAP-1 protein expression is significantly decreased in intratumoral vessels compared with peritumoral ones; this difference was independent of the skin melanoma thickness PMID:15057044
  50. Plasma semicarbazide-sensitive amine oxidase (SSAO) is elevated in patients with type 1 and type 2 diabetes and has been implicated in the pathophysiology of diabetic late complications. PMID:15830186

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Protein Families
Copper/topaquinone oxidase family
Tissue Specificity
Strongly expressed on the high endothelial venules of peripheral lymph nodes and on hepatic endothelia. Also highly expressed in appendix, lung and small intestine. Expressed also in adipose tissue, in bone marrow, colon, heart, kidney, ovary, pancreas, p
Database Links

HGNC: 550

UNIGENE: Hs.198241

KEGG: hsa:8639

STRING: 9606.ENSP00000312326

OMIM: 603735

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1