Recombinant Human Lysine-specific demethylase 5A (KDM5A), partial

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
KDM5A
Uniprot NO.
Research Area
Transcription
Alternative Names
Histone demethylase JARID1A; JARID1A; Jumonji/ARID domain containing protein 1A; Jumonji/ARID domain-containing protein 1A; Kdm5a; KDM5A_HUMAN; Lysine-specific demethylase 5A; RBBP-2; RBBP2; RBP2; Retinoblastoma binding protein 2; Retinoblastoma-binding protein 2
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
437-603aa
Target Protein Sequence
EYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.3kD
Protein Length
Partial
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. Regulates specific gene transcription through DNA-binding on 5'-CCGCCC-3' motif. May stimulate transcription mediated by nuclear receptors. Involved in transcriptional regulation of Hox proteins during cell differentiation. May participate in transcriptional repression of cytokines such as CXCL12. Plays a role in the regulation of the circadian rhythm and in maintaining the normal periodicity of the circadian clock. In a histone demethylase-independent manner, acts as a coactivator of the CLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER1/2 and other clock-controlled genes and increases histone acetylation at PER1/2 promoters by inhibiting the activity of HDAC1. Seems to act as a transcriptional corepressor for some genes such as MT1F and to favor the proliferation of cancer cells.
Gene References into Functions
  1. ZEB1 play a crucial role in KDM5A induced function. PMID:29324315
  2. both KDM5A and KDM5B are involved in the lengthening of DICER1 PMID:28138513
  3. RBP2 promotes HIF-1alpha-VEGF-induced angiogenesis of non-small cell lung cancer via the Akt pathway. PMID:25162518
  4. promotes overexpression and activation of BCL2 in acute lymphoblastic leukemia development and progression PMID:27008505
  5. Ectopic overexpression of RBP2 can induce cancer stem cell-like (CSC) phenotypes through epithelial to mesenchymal transition in renal cell carcinoma cells by converting them to a more mesenchymal phenotype. PMID:27282106
  6. miR-34a promotes the osteogenic differentiation of human adipose-derived stem cells via the RBP2/NOTCH1/CYCLIN D1 coregulatory network. PMID:27453008
  7. This study aimed to explore the expression level of RBP2 in hepatocellular carcinoma (HCC) and its prognostic significance. PMID:28582381
  8. KDM5A suppresses ovarian cancer cell apoptosis under paclitaxel treatment. PMID:28714030
  9. KDM5A 5A inhibitor blocks cancer cell growth and drug resistance PMID:27224921
  10. KDM5A-mediated H3K4me3 modification participated in the etiology of osteoporosis and may provide new strategies to improve the clinical efficacy of BMP2 in osteoporotic conditions. PMID:27512956
  11. KDM5A demethylates H3K4 to allow ZMYND8-NuRD to operate within damaged chromatin to repair DNA double strand breaks. PMID:28572115
  12. the radiation sensitivity observed following depletion of Jarid1A is not caused by a deficiency in repair of DNA double-strand breaks. PMID:27253695
  13. Treatment-induced temozolimide resistance in glioblastoma cells involves KDM5A mediated epigenetic mechanisms. PMID:26566863
  14. Characterization of a Linked Jumonji Domain of the KDM5/JARID1 Family of Histone H3 Lysine 4 Demethylases. PMID:26645689
  15. KDM5A is regulated by its reader domain through a positive-feedback mechanism PMID:25686748
  16. Data indicate that lysine (K)-specific demethylase 5A RBP2 (JARID1A; KDM5A) epigenetically downregulated micrRNA-21 (miR-21) in blast transformation of chronic myeloid leukemia (CML). PMID:25575817
  17. LSD1 is a more sensitive molecular marker than RBP2 on thyroid cancer diagnosis. PMID:24068396
  18. MiR-212 directly regulates the expression of RBP2 and inhibits cell growth in gastric cancer, which may provide new clues to treatment. PMID:23794145
  19. RBP2 is critical for breast cancer metastasis to the lung in multiple in vivo models. Mechanistically, RBP2 promotes metastasis as a pleiotropic positive regulator of many metastasis genes, including TNC. PMID:24582965
  20. RBP2 is overexpressed in HCC and negatively regulated by hsa-miR-212. The hsa-miR-212-RBP2-CDKI pathway may be important in the pathogenesis of HCC. PMID:23922798
  21. Overexpression of RBP2 and activation of VEGF might play important roles in human gastric cancer development and progression. PMID:24716659
  22. RBP2 is overexpressed in gastric cancer, and its inhibition triggers senescence of malignant cells at least partially by derepressing its target genes cyclin-dependent kinase inhibitors. PMID:19850045
  23. our results establish an oncogenic role for RBP2 in lung tumorigenesis and progression and uncover novel RBP2 targets mediating this role. PMID:23722541
  24. RBP2 down-regulated the expression of E-cadherin, up-regulated the expression of N-cadherin and snail, and induced epithelial-mesenchymal transition in non-small cell lung cancer cells. PMID:24376841
  25. RBP2 may link chronic inflammation to tumor development. PMID:25015565
  26. Epigenetic changes mediated by JARID1A, SMYD3 and DNA methylation may be responsible, at least in part, for the functional progesterone withdrawal that precipitates human labour. PMID:24442343
  27. KDM5A and the NuRD complex cooperatively function to control developmentally regulated genes PMID:25190814
  28. ARID is required for RBP2 demethylase activity in cells and that DNA recognition is essential to regulate transcription PMID:18270511
  29. High expression of KDM3B and KDM5A is associated with a better prognosis (no recurrence after mastectomy p=0.005 and response to docetaxel p=0.005)in breast cancer patients. PMID:23266085
  30. In terminally differentiated cells, common KDM5A and E2F4 gene targets were bound by the pRB-related protein p130, a DREAM complex component. PMID:23093672
  31. Jarid1a/b-mediated H3K4 demethylation contributes to silencing of retinoblastoma target genes in senescent cells, suggesting a mechanism by which retinoblastoma triggers gene silencing. PMID:22615382
  32. Evidence was provided that chronic drug exposure generated drug-tolerant cells via epigenetic mechanisms involving molecules such as CD44 and KDM5A. PMID:21935404
  33. JARID1A or a locus in strong linkage disequilibrium with it is a positional candidate for susceptibility to AS. PMID:21562575
  34. that H3K4 tri- and dimethylation play an important role and JARID1A is the histone-demethylating enzyme responsible for removal of this mark PMID:21348942
  35. Mad1 recruits RBP2 to the hTERT promoter that, in turn, demethylates H3-K4, thereby contributing to a stable repression of the hTERT gene in normal or differentiated malignant cells. PMID:19762557
  36. that RBP2-H1 exerts a broad tumor-suppressive function partially mediated by pRb modulation PMID:16645588
  37. Study shows that RBP2 is displaced from Hox genes during embryonic stem cell differentiation correlating with an increase of their di- and trimethylated histone 3 lysine 4 levels and expression. PMID:17320161
  38. RBP2 associates with MRG15 complex to maintain reduced H3K4 methylation at transcribed regions, which may ensure the transcriptional elongation state PMID:17573780
  39. During differentiation, RBP2 exerts inhibitory effects on multiple genes through direct interaction with their promoters. PMID:18722178
  40. fusing an H3K4-trimethylation-binding PHD finger, such as the carboxy-terminal PHD finger of JARID1A, to a common fusion partner NUP98, generated potent oncoproteins that arrested haematopoietic differentiation and induced acute myeloid leukaemia PMID:19430464

Show More

Hide All

Subcellular Location
Nucleus, nucleolus. Nucleus.
Protein Families
JARID1 histone demethylase family
Database Links

HGNC: 9886

UNIGENE: Hs.76272

KEGG: hsa:5927

STRING: 9606.ENSP00000382688

OMIM: 180202

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1