Recombinant Human Left-right determination factor 2 (LEFTY2)

In Stock
Code: CSB-EP012858HU
Size:
20μg
20μg100μg1mg(1mg*1 or 500ug*2)
US$306
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
LEFTY2
Uniprot NO.
Research Area
Cancer
Alternative Names
EBAF; Endometrial bleeding associated factor (left right determination factor A transforming growth factor beta superfamily); Endometrial bleeding associated factor; Endometrial bleeding-associated factor; Left right determination factor 2; Left right determination factor A; Left-right determination factor 2; Left-right determination factor A; LEFTA; LEFTY 2; LEFTY2; LEFTYA; LFTY2 transforming growth factor; beta -4; LFTY2; mouse; homolog of; LFTY2_HUMAN; MGC46222; Protein lefty 2; Protein lefty A; Protein lefty-2; Protein lefty-A; Protein lefty2; PSEC0024; TGF beta 4; TGF-beta-4; TGFB4; Transforming growth factor beta 4; Transforming growth factor beta-4
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
77-366aa
Target Protein Sequence
RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Inserting the gene encoding the Human LEFTY2 protein (77-366aa) into a plasmid vector results in the creation of recombinant plasmid, which is introduced into e.coli cells. e.coli cells that can survive in the presence of a specific antibiotic are selected, indicating successful uptake of the recombinant plasmid. The e.coli cells containing the recombinant plasmid are cultured under conditions promoting the expression of the gene of interest. A N-terminal 10xHis tag and C-terminal Myc tag is linked to the protein. After expression, affinity purification is used to isolate and purify the recombinant Human LEFTY2 protein from the cell lysate. Denaturing SDS-PAGE is then applied to resolve the resulting recombinant Human LEFTY2 protein, revealing a purity level exceeding 85%.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Required for left-right (L-R) asymmetry determination of organ systems in mammals. May play a role in endometrial bleeding.
Gene References into Functions
  1. functional role of LEFTY during progesterone therapy for endometrial carcinoma PMID:29268772
  2. LeftyA leads to disruption of Rac1 and Pak1 activity with subsequent actin depolymerization, cell softening and cell shrinkage. PMID:27404958
  3. LEFTY2 down-regulates MKi67 expression and FAK activity, up-regulates miR-200a and E-cadherin, and is thus a powerful negative regulator of endometrial cell proliferation and migration. PMID:27497669
  4. LEFTY2 regulates the expression and activity of ENaC in endometrial epithelial cells via SGK1. PMID:27606670
  5. Lefty A may account for the tumor suppressive activity of human adult stem cells. PMID:22469982
  6. Findings suggest that Lefty2 is negatively modulated by miR-302s in hESCs, which plays an important role in maintaining the balance between pluripotency and germ layer specification. PMID:21266536
  7. Findings show that during embryonic development, EBAF/LEFTY B plays important roles in decidualization and embryo implantation. PMID:21401636
  8. findings show that the TGFB4 (ebaf) mRNA has distinct tumor specific expression PMID:9230066
  9. may provide a crucial signal for endometrial breakdown and bleeding by triggering expression of several matrix metalloproteinases PMID:12215426
  10. nodal and the inhibitors of Nodal signaling, lefty-A and lefty-B, are down-regulated very early upon differentiation of human embryonic stem cells PMID:15308665
  11. Addition of recombinant LEFTY-A to explants induced MMP-9 in most samples, a response prevented by ovarian steroids. PMID:15536155
  12. LEFTY proteins, which are known to play a major role during mouse gastrulation, are transiently expressed during human embryonic stem cell differentiation. PMID:17038673

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
TGF-beta family
Tissue Specificity
Mesenchymal cells of the endometrial stroma.
Database Links

HGNC: 3122

UNIGENE: Hs.520187

KEGG: hsa:7044

STRING: 9606.ENSP00000355785

OMIM: 601877

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products