Home
Product
Protein
Recombinant Proteins
Recombinant Human L-lactate dehydrogenase C chain (LDHC), partial

Recombinant Human L-lactate dehydrogenase C chain (LDHC), partial

In Stock

Code: CSB-EP012844HU

Rate （N/A）
Review （0）

Size:

20μg100μg1mg(1mg*1 or 500ug*2)

US$306

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: N-terminal 6xHis-SUMO-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

LDHC

Uniprot NO.

P07864

Research Area

Cancer

Alternative Names

Cancer/testis antigen 32; CT32; EC 1.1.1.27 ; L lactate dehydrogenase C chain; L-lactate dehydrogenase C chain; Lactate Dehydrogenase C; Lactate dehydrogenase c variant 1; Lactate dehydrogenase c variant 3; Lactate dehydrogenase c variant 4; Lactate dehydrogenase C4; LDH C; LDH testis subunit; LDH X ; LDH-C; LDH-X; LDH3 ; ldhc; LDHC_HUMAN; LDHX ; MGC111073

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

2-332aa

Target Protein Sequence

STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

52.2kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Tris-based buffer,50% glycerol

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Possible role in sperm motility.

Gene References into Functions

Lactate dehydrogenase C may act as a novel biomarker for renal cell carcinoma progression and a potential therapeutic target for the treatment of renal cell carcinoma. PMID:28351304
three uniquely identified proteins (CDK6 , galectin-3-binding protein and LDH C) were found, which show tight connection with prostate cancer and presence of all of them was previously linked to certain aspects of prostate cancer PMID:26503549
Down-regulated LDH-C4 expression is significantly correlated with lowered enzyme activity in human spermatozoa. PMID:25795631
This is the first report to show a positive correlation between LDH-3 and hemolytic parameters in sickle cell anemia. PMID:26069337
LDH3 was increased in essential thrombocythemia. This isoenzymatic pattern could be expression of a metabolic adaptation. PMID:17178662
LDH3 is a supporting diagnostic marker in cases of chronic tuberculosis. PMID:17935709
hLdhc expression in cancer cells was regulated by transcription factor Sp1 and CREB and promoter CGI methylation PMID:18930904