Abbreviation
Recombinant Human IL23A&IL12B Heterodimer protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human IL23A&IL12B at 2 μg/mL can bind Anti-IL23A&IL12B recombinant antibody (CSB-RA011587MA2HU). The EC50 is 0.7293-0.8610 ng/mL.
②IL23A&IL12B Recombinant Monoclonal Antibody captured on Protein A Chip can bind Recombinant Human IL23A&IL12B (CSB-MP6901HU) with an affinity constant of 0.158 nM as detected by MetaSPR Assay (WeSPRTM 200).
Species
Homo sapiens (Human)
Expression Region
20-189aa(IL23A) & 23-328aa(IL12B)
Target Protein Sequence
RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.3 kDa & 37.7 kDa
Protein Length
Heterodimer
Tag Info
N-terminal 10xHis-tagged & C-terminal Twin-Strep-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL23A&IL12B at 2 μg/ml can bind Anti-IL23A&IL12B recombinant antibody (CSB-RA011587MA2HU). The EC50 is 0.7293-0.8610 ng/mL.
-
Activity
IL23A&IL12B Recombinant Monoclonal Antibody captured on Protein A Chip can bind Recombinant Human IL23A&IL12B (CSB-MP6901HU) with an affinity constant of 0.158 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description
IL-23 drives Th17 differentiation and sustains chronic inflammatory responses, making precise quantification of its receptor engagement essential for modeling autoimmune pathology and evaluating therapeutic candidates. This heterodimeric protein demonstrates sub-nanomolar affinity (KD = 0.158 nM) to its cognate antibody in surface plasmon resonance assays and exhibits an EC50 of 0.73–0.86 ng/mL in functional ELISA, providing quantitative benchmarks for antibody development, epitope mapping, and competitive binding studies. Endotoxin levels below 1.0 EU/μg prevent LPS-driven artifacts in primary T cell differentiation assays, PBMC activation panels, and JAK/STAT signaling experiments where even trace contamination can confound cytokine-specific readouts. The protein spans residues 20–189 of IL-23A and 23–328 of IL-12B, preserving the mature heterodimer interface required for IL-23R engagement, and satisfies the purity criteria typical for use as an ELISA coating antigen, Western blot positive control, or immunogen in monoclonal antibody campaigns targeting IL-23-driven inflammatory pathways.
