Home
Product
Protein
Active Protein
Interleukin
Recombinant Human IL23A & IL12B Heterodimer Protein (Active)

Recombinant Human IL23A & IL12B Heterodimer Protein (Active)

In Stock

Code: CSB-AP004661HU

Rate （N/A）
Review （0）

Size:

10ug50ug500ug1mg

US$290

Quantity:

Express system: Mammalian cell

Species: Homo sapiens (Human)

Tag Info: C-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Human IL23A&IL12B Heterodimer protein (Active)

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The ED50 as determined by its ability to induce STAT reporter activity in 293F human embryonic kidney cells is 70-210 ng/ml.

Uniprot NO.

Q9NPF7&P29460

Research Area

Immunology

Alternative Names

IL 23 A; IL 23; IL 23 subunit alpha; IL 23A; IL 23p19; IL-23 subunit alpha; IL-23-A; IL-23p19; IL12B; IL23; Il23a; IL23A_HUMAN; IL23P19; interleukin 12B; Interleukin 23 alpha subunit p19; Interleukin 23 p19 subunit; interleukin 23 subunit alpha; interleukin 23 subunit p19; interleukin six; G CSF related factor; Interleukin-23 subunit alpha; Interleukin-23 subunit p19; JKA3 induced upon T cell activation; MGC79388; P19; SGRF

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

20-189aa & 23-328aa

Target Protein Sequence

RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP & IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

19.5kDa&35.5kDa

Protein Length

Heterodimer

Tag Info

C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm filtered 20mM PB, 200mM Trehalose, 4% Mannitol, 50mM NaCl, 0.02% Tween80, pH7.5.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

IL-23 drives Th17 differentiation and sustains inflammatory responses, making it a critical target in autoimmune and tumor immunology research. This recombinant human IL-23 heterodimer (IL-23A aa 20–189 paired with IL-12B aa 23–328) demonstrates confirmed signaling potency with an ED50 of 70–210 ng/mL in a STAT reporter assay using 293F cells, supporting JAK/STAT pathway studies, Th17 polarization assays, and functional screening in antibody development campaigns. The C-terminal 6×His tag enables straightforward purification and oriented immobilization for use as a coating antigen in ELISA or as a reference standard in cytokine detection platforms. Mammalian-expressed to preserve native folding and post-translational modifications, this heterodimer provides greater than 95% purity and endotoxin levels below 1.0 EU/μg, satisfying the stringent criteria required to prevent LPS-driven artifacts in primary immune cell activation and in vivo inflammation models.