Abbreviation
Recombinant Human IL21R protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human IL21R at 2 μg/mL can bind Human IL21 (CSB-MP872537HU). The EC50 is 16.65-19.49 ng/mL. ②Human IL21 (CSB-MP872537HU) captured on Protein A Chip can bind Recombinant Human IL21R with an affinity constant of 1.87 nM as detected by MetaSPR Assay (WeSPRTM 200).
Alternative Names
Interleukin-21 receptor; IL-21 receptor; IL-21R; Novel interleukin receptor; CD antigen CD360
Species
Homo sapiens (Human)
Expression Region
20-236aa
Target Protein Sequence
CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL21R at 2 μg/ml can bind Human IL21 (CSB-MP872537HU). The EC50 is 16.65-19.49 ng/mL.
-
Activity
Human IL21 (CSB-MP872537HU) captured on Protein A Chip can bind Recombinant Human IL21R with an affinity constant of 1.87 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description
IL-21 signaling through its cognate receptor drives T cell and NK cell differentiation in tumor immunity and autoimmune contexts, making quantitative characterization of this interaction essential for therapeutic development. This mammalian-expressed extracellular domain (aa 20–236) demonstrates a binding affinity of 1.87 nM to human IL-21 as measured by surface plasmon resonance, providing a validated reagent for competitive inhibition assays and blocking antibody screening campaigns. The protein exhibits an EC50 of 16.65–19.49 ng/mL in functional ELISA, supporting its use in ligand-binding studies, therapeutic antibody epitope mapping, and small-molecule inhibitor screening workflows where dose-response precision is critical. Endotoxin levels below 1.0 EU/μg and purity exceeding 95% satisfy the quality thresholds commonly required for SPR, biolayer interferometry, and cell-based assays in immuno-oncology drug discovery.
