Recombinant Human Interleukin-18-binding protein (IL18BP)

CSB-MP011609HU
Size:
100ug
100ug1mg
US$156
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal hFc1-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Target Names
IL18BP
Uniprot NO.
Research Area
Immunology
Alternative Names
Tadekinig-alfa
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
31-194aa
Target Protein Sequence
TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
Mol. Weight
45.1 kDa
Protein Length
Full Length of Mature Protein of Isoform 2
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.59.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.
Gene References into Functions
  1. these results were corroborated in female osteoporotic subjects where decreased serum IL-18BP levels and enhanced serum IL-18 levels were observed. Our study forms a strong basis for using humanized IL-18BP towards the treatment of postmenopausal osteoporosis. PMID:27649785
  2. epigenetic silencing by single CpG methylation determines differential IL18BP inducibility in monocytic versus epithelial cells. T PMID:29409936
  3. a large proportion blood basophils from patients with asthma express IL-18 and IL-18BP. mast cells and basophils are implicated in the pathogenesis of asthma via an IL-18-related mechanism. PMID:29505668
  4. The maintenance of normal production of IL-18BP may contribute, at least in part, to the ability ofLong Term Non-Progressors to delay AIDS progression. PMID:27863336
  5. Platelets also contain the IL-18 antagonist, the IL-18-Binding Protein (IL-18BP); however, it is not synthesized in them de novo, is present in pre-made form and is released irrespective of platelet activation. PMID:27914933
  6. The serum levels of IL-37, which were correlated with antibody production and the serum levels of total IL-18 and IL-18BP, were elevated in the patients with primary Sjogren's syndrome. PMID:28057714
  7. an imbalance in the production of IL-18 and its antagonist (an increase in the production of IL-18 with a decrease, no increase or an insufficient increase in the production of IL-18BP) has been described in many chronic inflammatory diseases in humans. PMID:26898120
  8. IL-18, IL-18R and IL-18BP expression in eosinophil are involved in the inflammatory reaction of asthma. PMID:28395725
  9. the inhibition of IL-18 signaling by IL-18BPa may be involved in the development of pulmonary vascular involvement leading to pulmonary hypertension and modulate the systemic inflammation in systemic sclerosis PMID:26777734
  10. The natural IL-18 inhibitor IL-18BP further regulates IL-18 activity in the extracellular environment. Review. PMID:25548255
  11. imbalance of IL-18/IL-18BP ratio in IgA nephropathy especially in patients with arteriolar lesions PMID:25807634
  12. IL-18, IL-18BP, and IL-18R may have roles in the pathogenesis of epithelial ovarian carcinoma PMID:24963217
  13. HPV16 E7 oncoprotein increases production of the IL18BP in keratinocytes. PMID:24478434
  14. these data indicate that IL-18BP, which is produced in EOC in response to microenvironmental factors, may inhibit endogenous or exogenous IL-18 activity PMID:23873689
  15. Data suggest that the imbalance of IL-18/IL-18BP might play an important role in the pathogenesis of systemic juvenile idiopathic arthritis (SJIA) and it might go hand-in-hand with the severity of SJIA. PMID:23419721
  16. Due to highly significant increases in circulating IL-18BP in schizophrenia compared to controls, the levels of free IL-18 are not significantly different between schizophrenic groups. PMID:22913567
  17. Imbalance between IL-18 and IL-18BP may play an important role in pathogenesis of idiopathic thrombocytopenic purpura. PMID:21867627
  18. High IL-18 BP levels indicate the severity of existing glomerular injury in systemic lupus erythematosus. PMID:21656327
  19. The balance between interleukin-18 (IL-18) and its endogenous antagonist, IL-18 binding protein (IL-18BP), was evaluated in children with Henoch-Schonlein purpura. PMID:22289535
  20. IL-18/IL-18BP imbalance plays an important role in pathogenesis of primary immune thrombocytopenia. PMID:21418867
  21. In T2DM patients, 18 BP began to increase after IL-18 increased and reached a threshold, in which case kidney dysfunction would have developed. PMID:21440322
  22. increased levels of both IL-18 and its natural inhibitor IL-18BP, characterise SLE PMID:21126942
  23. In lines of intestinal epithelial cells from inflammatory bowel disease patients, interferon-gamma selectively up-regulated IL-18 binding protein. PMID:21078084
  24. lupus nephritis patients present lower IL-18BP mRNA expression and higher serum levels of IL-18 than those in normal controls PMID:20140691
  25. Altogether, data presented herein indicate that direct action of STAT1 on the IL-18BP promoter at the proximal GAS element is key to IL-18BP expression by IFN-gamma-stimulated DLD-1 colon carcinoma cells PMID:19046253
  26. High circulating levels in patients with active Systemic Lupus Erythematosus PMID:19699611
  27. Endometrial interleukin-18 binding protein mRNA expression may possibly be responsible for the pathologic process of adenomyosis. PMID:19394601
  28. Suggest that an early rise in IL-18 levels may play a role in reverse remodeling process following aortic valve replacement. PMID:19961286
  29. Since IL-18 plays a major role in perpetuating hemophagocytosis, the failure of IFNgamma to induce IL-18BP may constitute a fundamental pathogenetic mechanism PMID:20072626
  30. trancriptional activation and release of IL-18 binding protein in response to IFN-gamma PMID:11739524
  31. IL-18BP messenger transcript and protein are significantly increased in surgically resected specimens from active Crohn's disease compared with control patients, correlating with an up-regulation of IL-18. PMID:11907126
  32. after binding to IL-18BP, IL-1F7b forms a complex with IL-18Rbeta, depriving the beta-chain of forming a functional receptor complex with IL-18Ralpha and thus inhibiting IL-18 activity PMID:12381835
  33. IRF-1-CEBPbeta complex activate the promoter of IL-18 binding protein. PMID:12482935
  34. Administration of recombinant human IL-18BP not only reduces symptoms of murine contact hypersensitivity (CHS) during the elicitation phase but also significantly decreases inflammation in mice that had previously undergone CHS without treatment. PMID:12874202
  35. High endogenous levels of IL-18BP in trangenic mice effectively neutralize IL-18 and are protective in response to different inflammatory stimuli. PMID:12960225
  36. production of IL-18BP in response to IL-12 and IL-18 was regulated differently in blood and synovial cells. PMID:15188356
  37. IL-18 levels, which are determined in part by variation in IL18/IL18BP, play a role in coronary heart disease development and postsurgery outcome. PMID:17951325
  38. Despite the elevated IL-18BP levels during active disease, free IL-18 remained higher than in the inactive disease stages, suggesting a potential benefit of administration of exogenous IL-18BP as a therapeutic approach for active Wegener's granulomatosis. PMID:18594952

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Strongly expressed in heart, lung, placenta and spleen.
Database Links

HGNC: 5987

UNIGENE: Hs.591967

KEGG: hsa:10068

STRING: 9606.ENSP00000260049

OMIM: 604113

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products