Abbreviation
Recombinant Human IL1B protein (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human IL1B at 5 μg/mL can bind Human IL1R2(CSB-MP011622HU1). The EC50 is 89.65-100.5 ng/mL.
Alternative Names
Interleukin-1 beta; IL-1 beta; Catabolin; IL1B; IL1F2
Species
Homo sapiens (Human)
Expression Region
117-269aa
Target Protein Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human IL1B at 5 μg/ml can bind Human IL1R2(CSB-MP011622HU1). The EC50 is 89.65-100.5 ng/mL.
Description
IL-1β drives pyrogenic and pro-inflammatory responses through IL-1R1 engagement, making precise receptor-binding kinetics essential for modeling innate immune activation and therapeutic target validation. This mammalian-expressed protein, spanning the full mature sequence (aa 117–269), demonstrates specific IL-1R2 binding with an EC50 of 89.65–100.5 ng/mL in functional ELISA, providing quantitative evidence that supports its use in cell-based assays measuring NF-κB or MAPK pathway activation in primary monocytes, macrophages, or endothelial cells. Endotoxin levels below 1.0 EU/μg meet the contamination thresholds commonly required for experiments where LPS artifacts would confound interpretation of IL-1β-specific effects, including PBMC proliferation studies and in vivo inflammation models. Purity exceeding 90% by SDS-PAGE, combined with the validated receptor interaction, makes this protein appropriate for antibody development workflows and as a positive control in cytokine detection platforms.