Abbreviation
Recombinant Human ROR1 protein, partial, Biotinylated (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Anti-ROR1 recombinant antibody(CSB-RA020067MA2HU) at 2 μg/mL can bind Human ROR1.The EC50 is 21.01-24.28 ng/mL.
Alternative Names
Inactive tyrosine-protein kinase transmembrane receptor ROR1; Neurotrophic tyrosine kinase, receptor-related 1
Species
Homo sapiens (Human)
Expression Region
30-403aa
Target Protein Sequence
QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-Avi-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Anti-ROR1 recombinant antibody(CSB-RA020067MA2HU) at 2 μg/ml can bind Human ROR1.The EC50 is 21.01-24.28 ng/mL.
-
The purity of ROR1 was greater than 95% as determined by SEC-HPLC
Description
ROR1 is a receptor tyrosine kinase-like orphan receptor implicated in cancer cell survival and migration, making it a priority target for therapeutic antibody development and small-molecule inhibitor discovery. This biotinylated extracellular domain fragment (residues 30–403) produced in mammalian cells demonstrates quantifiable binding to an anti-ROR1 antibody with an EC50 of 21.01–24.28 ng/mL in functional ELISA, confirming conformational integrity suitable for ligand-binding assays, competitive inhibition screens, and therapeutic antibody epitope mapping. The site-specific biotinylation via C-terminal Avi-tag enables oriented immobilization in surface plasmon resonance and biolayer interferometry experiments for affinity characterization and blocking antibody validation, while mammalian expression supports native glycosylation patterns critical for physiologically relevant receptor-ligand interactions. Purity exceeding 95% by both SDS-PAGE and SEC-HPLC, combined with endotoxin levels below 1.0 EU/μg, meets the quality thresholds commonly required for antibody screening campaigns and biologic inhibitor development in oncology research.