Abbreviation
Recombinant Human ROR1 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized ROR1 at 2 μg/mL can bind anti-ROR1 antibody（CSB-RA020067A1HU）, the EC50 is 0.2450-0.3416 ng/mL.
Research Area
Neuroscience
Alternative Names
(Neurotrophic tyrosine kinase, receptor-related 1)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
30-403aa
Target Protein Sequence
QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized ROR1 at 2 μg/ml can bind anti-ROR1 antibody（CSB-RA020067A1HU）, the EC50 is 0.2450-0.3416 ng/mL.
-
The purity of ROR1 was greater than 90% as determined by SEC-HPLC
-
ROR1 Recombinant Monoclonal Antibody (CSB-RA020067A1HU) captured on Protein A Chip can bind Recombinant Human ROR1 protein with an affinity constant of 0.305 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description
ROR1 has emerged as a compelling therapeutic target in oncology and neuroscience due to its restricted expression in adult tissues and overexpression in multiple malignancies. This recombinant construct spans the extracellular region (aa 30–403), encompassing the immunoglobulin-like, cysteine-rich, and kringle domains critical for ligand engagement and antibody recognition, and is expressed in mammalian cells to preserve native glycosylation and conformational integrity. Functional ELISA confirms robust binding activity, with immobilized ROR1 at 2 μg/mL engaging anti-ROR1 antibody at an EC50 of 0.245–0.342 ng/mL, supporting direct use in therapeutic antibody epitope mapping, competitive blocking antibody screening, and affinity characterization by SPR or BLI. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for receptor-ligand interaction assays and small-molecule or biologic inhibitor screening in drug discovery workflows.
