Recombinant Human Histone acetyltransferase type B catalytic subunit (HAT1)

In Stock
Code: CSB-EP010143HU
Size:
20ug
20ug100ug1mg
US$306
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human HAT1 protein
Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
HAT1
Uniprot NO.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Histone acetyltransferase 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-419aa
Target Protein Sequence
AGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMVIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
56.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.153.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Histone acetyltransferase that plays a role in different biological processes including cell cycle progression, glucose metabolism, histone production or DNA damage repair. Coordinates histone production and acetylation via H4 promoter binding. Acetylates histone H4 at 'Lys-5' (H4K5ac) and 'Lys-12' (H4K12ac) and, to a lesser extent, histone H2A at 'Lys-5' (H2AK5ac). Drives H4 production by chromatin binding to support chromatin replication and acetylation. Since transcription of H4 genes is tightly coupled to S-phase, plays an important role in S-phase entry and progression. Promotes homologous recombination in DNA repair by facilitating histone turnover and incorporation of acetylated H3.3 at sites of double-strand breaks. In addition, acetylates other substrates such as chromatin-related proteins. Acetylates also RSAD2 which mediates the interaction of ubiquitin ligase UBE4A with RSAD2 leading to RSAD2 ubiquitination and subsequent degradation.; (Microbial infection) Contributes to hepatitis B virus (HBV) replication by acetylating histone H4 at the sites of 'Lys-5' and 'Lys-12' on the covalently closed circular DNA (cccDNA) minichromosome leading to its accumulation within the host cell.
Gene References into Functions
  1. The expression of HAT1 and MYST1, did not differ between drug-sensitive and -resistant cells PMID:18458078
  2. Human histone acetyltransferase 1 (Hat1) acetylates lysine 5 of histone H2A in vivo. PMID:24682716
  3. The high-resolution crystal structure of a Hat1p/Hat2p/CoA/H4 peptide complex was solved and it was found that the H4 tail interacts with both Hat1p and Hat2p, by which substrate recruitment is facilitated. It was discovered that H3 N-terminal peptides can bind to the Hat2p WD40 domain. PMID:24835250
  4. Signalling from Toll-like or TNF-alpha receptors triggers the calcium/calmodulin-dependent protein kinase (CaMK2) to activate histone acetyltransferase-1 (HAT1), which then acetylates the transcriptional regulator PLZF. Acetylation of PLZF promotes the assembly of a repressor complex incorporating HDAC3 and the NF-kappa B p50 subunit that limits the NF-kappa B response. PMID:25865065
  5. HAT1 is involved in the STAT5 binding to the Bcl2L12 promoter. HAT1 increased the expression of Bcl2L12. Bcl2L12 mediated the effects of HAT1 on suppressing NPC cell apoptosis. Absorption of the HAT1 shRNA plasmid-carrying liposomes induced NPC cell apoptosis. In conclusion, inhibition of HAT1 can induce NPC cell apoptosis via increasing Bcl2L12 expression, which can be a potential therapy for NPC treatment. PMID:29621521
  6. HAT1 was upregulated in hepatocellular carcinoma.HAT1 acts as an oncogenic protein promoting cell proliferation and inducing cisplatin resistance in hepatocellular carcinoma. PMID:27938492
  7. Nuclear HDAC2 immunopositivity was significantly higher in actinic cheilitis (AC) when compared with lip squamous cell carcinoma (LSCC). HDAC1 and HAT1 nuclear immunostaining were higher in AC, with no statistical significance. When comparing data with our previous study, we found a positive correlation between HDAC1 X DNMT1/DNMT3b, HDAC2 X DNMT3b, and HAT1 X DNMT1/DNMT3b for certain studied groups. PMID:28107582
  8. AMPK phosphorylates DNMT1, RBBP7, and HAT1 and increases interactions of DNMT1, RBBP7, and HAT1. PMID:28143904
  9. Results show a novel interaction of the Lsm4 RGG domain with HAT1 and RBBP7, leading to the possibility of a posttranslational modifications network involved in mRNP regulation. PMID:27247266
  10. These data indicated that miR-486 aggravate the cholesterol accumulation in THP-1 cells by targeting HAT1. PMID:26654953
  11. The expression of HAT1 was higher in the primary Esophageal carcinoma tumors and adjacent tissue as compared to that of the normal esophageal tissue and HAT1 expression was directly correlated with the poor tumor differentiation PMID:25120766
  12. Data indicate that HAT1 is required for homologous recombination in DNA repair. PMID:23653357
  13. the role of Hat1 in DNA damage repair is evolutionarily conserved, the ability of H3 acetylation to compensate for Hat1 deletion appears to be more variable PMID:17052979
  14. HAT gene expression is required for cisplatin resistance and Clock and Tip60 regulate not only transcription, but also DNA repair, through periodic histone acetylation PMID:18458078

Show More

Hide All

Subcellular Location
[Isoform A]: Nucleus matrix. Mitochondrion.; [Isoform B]: Cytoplasm. Nucleus. Nucleus matrix. Nucleus, nucleoplasm.
Protein Families
HAT1 family
Database Links

HGNC: 4821

UNIGENE: Hs.632532

KEGG: hsa:8520

STRING: 9606.ENSP00000264108

OMIM: 603053

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products