Recombinant Human HLA class I histocompatibility antigen, C alpha chain (HLA-C), partial

Code: CSB-EP326978HU
Size:
20ug
20ug100ug1mg
US$306
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human HLA-C protein, partial
Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
HLA-C
Uniprot NO.
Research Area
Immunology
Alternative Names
HLA-Cw;Human leukocyte antigen C
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
25-308aa
Target Protein Sequence
CSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.4 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Antigen-presenting major histocompatibility complex class I (MHCI) molecule with an important role in reproduction and antiviral immunity. In complex with B2M/beta 2 microglobulin displays a restricted repertoire of self and viral peptides and acts as a dominant ligand for inhibitory and activating killer immunoglobulin receptors (KIRs) expressed on NK cells. In an allogeneic setting, such as during pregnancy, mediates interaction of extravillous trophoblasts with KIR on uterine NK cells and regulate trophoblast invasion necessary for placentation and overall fetal growth. During viral infection, may present viral peptides with low affinity for KIRs, impeding KIR-mediated inhibition through peptide antagonism and favoring lysis of infected cells. Presents a restricted repertoire of viral peptides on antigen-presenting cells for recognition by alpha-beta T cell receptor (TCR) on HLA-C-restricted CD8-positive T cells, guiding antigen-specific T cell immune response to eliminate infected cells, particularly in chronic viral infection settings such as HIV-1 or CMV infection. Both the peptide and the MHC molecule are recognized by TCR, the peptide is responsible for the fine specificity of antigen recognition and MHC residues account for the MHC restriction of T cells. Typically presents intracellular peptide antigens of 9 amino acids that arise from cytosolic proteolysis via proteasome. Can bind different peptides containing allele-specific binding motifs, which are mainly defined by anchor residues at position 2 and 9. Preferentially displays peptides having a restricted repertoire of hydrophobic or aromatic amino acids (Phe, Ile, Leu, Met, Val and Tyr) at the C-terminal anchor.; ALLELE C*01:02: The peptide-bound form interacts with KIR2DL2 and KIR2DL3 inhibitory receptors on NK cells. The low affinity peptides compete with the high affinity peptides impeding KIR-mediated inhibition and favoring lysis of infected cells. Presents to CD8-positive T cells a CMV epitope derived from UL83/pp65 (RCPEMISVL), an immediate-early antigen necessary for initiating viral replication.; ALLELE C*04:01: Presents a conserved HIV-1 epitope derived from env (SFNCGGEFF) to memory CD8-positive T cells, eliciting very strong IFNG responses. Presents CMV epitope derived from UL83/pp65 (QYDPVAALF) to CD8-positive T cells, triggering T cell cytotoxic response.; ALLELE C*05:01: Presents HIV-1 epitope derived from rev (SAEPVPLQL) to CD8-positive T cells, triggering T cell cytotoxic response.; ALLELE C*06:02: In trophoblasts, interacts with KIR2DS2 on uterine NK cells and triggers NK cell activation, including secretion of cytokines such as GMCSF that enhances trophoblast migration.; ALLELE C*07:02: Plays an important role in the control of chronic CMV infection. Presents immunodominant CMV epitopes derived from IE1 (LSEFCRVL and CRVLCCYVL) and UL28 (FRCPRRFCF), both antigens synthesized during immediate-early period of viral replication. Elicits a strong anti-viral CD8-positive T cell immune response that increases markedly with age.; ALLELE C*08:01: Presents viral epitopes derived from CMV UL83 (VVCAHELVC) and IAV M1 (GILGFVFTL), triggering CD8-positive T cell cytotoxic response.; ALLELE C*12:02: Presents CMV epitope derived from UL83 (VAFTSHEHF) to CD8-positive T cells.; ALLELE C*15:02: Presents CMV epitope derived from UL83 CC (VVCAHELVC) to CD8-positive T cells, triggering T cell cytotoxic response.
Gene References into Functions
  1. This study suggests that polytransfused patients with SCA possessing the HLA-DQB1*03 and HLA-C*06 allele variants are more susceptible to alloimmunisation. In addition, HLA-DRB1*04 and HLA-DRB1*11 alleles were seen to be associated with the production of anti-Fy(a) and anti-K antibodies, respectively. PMID:28881103
  2. Binding stability to beta2-microglobulin may confer to HLA-C the ability to preferentially act either as a conventional immune-competent molecule or as an accessory molecule involved in HIV-1 infectivity via viral envelope glycoprotein binding. PMID:28051183
  3. the results show that HLA-C incompatibility between couples is significantly associated with unexplained recurrent miscarriage PMID:29205643
  4. this study shows that HLA-C genetic variance is associated with HIV-1 viral load in seroconverters from Zambia and Rwanda PMID:29289742
  5. this study shows that HLA-C1 ligands are associated with increased susceptibility to systemic lupus erythematosus PMID:29395276
  6. this study demonstrates associations of ERAP1 coding variants and domain specific interaction with HLA-C *06 in the early onset psoriasis patients of India PMID:28867178
  7. Confirmation of the HLA-C*16:97 allele in multiple individuals in Italy, Croatia, Greece, and Turkey has been reported. PMID:28155256
  8. The results from this large cohort of European patients treated with ustekinumab in daily clinical practice confirm the role of HLA-C*06 as a potential predictor of response to ustekinumab. PMID:28207934
  9. In silico docking study have confirmed the high binding affinities of multiple 9-mer peptides derived from LL-37 to the HLA-C*06:02 molecule proposed a mechanism of the interaction between this LL-37-HLA-C*06:02 complex and T cells via TCRs. PMID:27189829
  10. Individuals carrying HLA-C rs9264942 TT genotype showed a significant increased level of HIV-1 viral load pre-treatment, in comparison with individuals carrying the CC genotype (p-value = 0.0092). PMID:28494720
  11. Human Leukocyte Antigen C*12:02:02 and Killer Immunoglobulin-Like Receptor 2DL5 are Distinctly Associated with Ankylosing Spondylitis in the Taiwanese PMID:28812990
  12. these study reports an association of the ERAP1 SNP rs30187 with the HLA-C*07 allele in inflammatory bowel disease in the Spanish population PMID:28651467
  13. The likely HLA class I C*05:142-bearing haplotype is A*02:01~C*05:142~B*44:02. This new allele has a maximum frequency of 0.00001, in 34,743 sequenced-based typed subjects, contrasting with that of C*05:01 (allele frequency 0.10441), in our local, largely UK European, blood donors. PMID:28639429
  14. In this study, we describe and confirm the distinct expression of HLA-F, HLA-G, HLA-E, and HLA-C in placental tissue PMID:28185362
  15. childhood acute lymphoblastic leukaemic patients but not healthy controls exhibited B cell populations with very low HLA-C and -E expression levels that could be consistently allocated to the CD19+CD45- leukaemic subset PMID:26527563
  16. propose that HIV-1 infectivity might depend both on the amounts of HLA-C molecules and on their stability as trimeric complex. According to this model, individuals with low-expression HLA-C alleles and unstable binding to beta2m/peptide might have worse control of HIV-1 infection and an intrinsically higher capacity to support viral replication PMID:29070683
  17. This study suggests a possible role of killer cell immunoglobulin-like receptors and their ligands in the development of liver damage. The absence of human leucocyte antigen C1 and C2 ligands heterozygosity could lead to less inhibition of natural killer cells and a quicker progression to a high level of fibrosis in patients infected with hepatitis C virus, especially following liver transplantation. PMID:26717049
  18. KIR2DL2/HLA-C( *)12:02 and KIR2DL2/HLA-C( *)14:03 compound genotypes have protective effects on control of HIV-1. PMID:27880898
  19. Data establish the C2 allele as a novel genetic risk factor associated with congenital heart block. This observation supports a model in which fetuses with C2 ligand expression and maternal anti-SSA/Ro positivity may have impaired NK cell surveillance, resulting in unchecked cardiac inflammation and scarring. PMID:29045069
  20. results provide the structural basis for understanding peptide repertoire selection in HLA-C*06:02. PMID:28855257
  21. Single-nucleotide polymorphisms FOXF1 rs9936833 and MHC rs9257809 remained significantly associated with presence of gastroesophageal acid reflux. The association for risk allele C in FOXF1 rs9936833 and risk allele A in MHC rs9257809 with the presence of acid reflux suggests a potential pathophysiologic mechanism for the role of genetic influences in Barret Esophagus development. PMID:26822871
  22. The minor alleles of rs2395029, rs9264942, and rs3689068 in the HCP5 and HLA-C, and ZNRD1 genes associate with lower viral loads (VL) among antiretroviral-naive individuals and with shorter time to first VL less 51 copies/ml during anti-HIV therapy. PMID:27083073
  23. HLA-C*04:01 predisposes to nevirapine-induced Stevens-Johnson syndrome/toxic epidermal necrolysis in , but not to other hypersensitivity phenotypes in a sub-Saharan African HIV-infected population PMID:28062682
  24. Genotyping analysis revealed that HLA-C2, which provides a ligand for killer-cell immunoglobulin-like receptors (KIR) expressed by NK cells, was strongly associated with psoriasis susceptibility. However, no link between the KIR genes themselves and disease was found PMID:26477484
  25. the signal overall signal that NK cells receive from paternal HLA-C on trophoblasts depends on the ratio of activating and inhibitory KIR genes expressed by them PMID:27751789
  26. data strengthen our understanding of HLA-C transcriptional regulation and provide a basis for understanding the potential consequences of manipulating HLA-C levels therapeutically PMID:27817866
  27. KIR2DS2/HLA-C1 may correlate with Hashimoto Thyroiditis pathogenesis. PMID:27042744
  28. The data suggested the association of IL12B with the psoriasis, however no evidence was observed for the epistatic effect of IL12B with HLA-Cw6 among the psoriasis patients in India. PMID:27829679
  29. this study first demonstrates hypermethylation of HLA-C gene in psoriatic epidermis, suggesting that HLA-C hypermethylation may be an epigenetic marker in psoriasis. PMID:27132688
  30. Homozygous HLA-Cw*0602 carriage in plaque psoriasis may predict a favorable outcome after tonsillectomy. The homozygotes more often had psoriasis onset associated with a throat infection and an increased frequency of streptococcal throat infections per lifetime. PMID:27520394
  31. the combined effect of HLA-Cw6 allele and risk associated genotype near LCE3A gene has a role in psoriasis in the Indian population PMID:27048876
  32. The absence of KIR-2DS1 in the mother and the presence of HLA-C2 ligand in the child were negatively associated with type 1 diabetes in the child. Our results indicate that maternal KIR genes and their interaction with foetal HLA-C2 may contribute to the risk of type 1 diabetes among Han Chinese children PMID:26991115
  33. this study shows that in HIV infection, spontaneous controllers express higher levels of HLA-C, along with NK cell activation PMID:27521484
  34. these results suggest that the HLA-C*06 allele is positively associated with susceptibility to psoriasis, female gender and early onset of psoriasis in South Indian Tamils. PMID:26796545
  35. gene polymorphism is associated with Crohn's disease in Spanish patients PMID:26542067
  36. Recurrent Pregnancy Loss in Women with Killer Cell Immunoglobulin-Like Receptor KIR2DS1 is Associated with an Increased HLA-C2 Allelic Frequency PMID:26589762
  37. genetic polymorphism is associated with the course of Hepatitis C virus infection and the response to therapy PMID:26206121
  38. HLA-C genetic polymorphism is associated with psoriasis. PMID:26470763
  39. HLA-C2 and -C1, showed highly significant associations with CRC development. PMID:26383988
  40. Therefore, the results obtained in this study demonstrate the involvement of HLA class I genes in the susceptibility or resistance to American cutaneous leishmaniasis (ACL), with significant association between HLA-C*04 and ACL susceptibility. PMID:26600554
  41. HLA-C expressed on HIV-infected cells restricts attack by KIR2DL(+) CD56(dim) natural killer (NK) cells PMID:26828202
  42. Absence of HLA-C2 for donor KIR2DL1 was associated with higher grade II to IV (HR, 1.4; P = .002) and III to IV acute GVHD (HR, 1.5; P = .01) compared with HLA-C2(+) patients. PMID:25960307
  43. The authors have identified a deleterious effect of the KIR2DL3-HLA-C1 receptor-ligand combination on HIV clinical outcomes in a Thai cohort. PMID:26372271
  44. HLA-C -35 C/C allele exerts a favorable effect on the immunological (higher baseline and nadir CD4+ T cell count) and virologic (lower pretreatment HIV viral load) variables. PMID:26068923
  45. Preformed anti-HLA-Cw and anti-HLA-DP donor specific antibodies have deleterious impact in kidney transplantation. PMID:26262501
  46. Data suggest regulatory interactions between major histocompatibility antigen HLA-C and killer cell Ig-like receptor (KIR) might promote Graft-versus-Leukemia effects following transplantation. PMID:26416275
  47. combination of maternal KIR AA with fetal HLA-C2 associated with increased incidence of preeclampsia in Chinese Han population PMID:24911933
  48. ). In conclusion, we found an interaction between the HLA-Cw6 and LCE genotypes on disease improvement among psoriatic patients treated with anti-TNFs. PMID:25794162
  49. Possible protective role of human leukocyte antigen Cw7 indicates polyoma BK virus-positive people can be accepted safely for kidney donation. PMID:25894195
  50. this is the first molecular study of HLA typing in Egyptian patients with vitiligo PMID:25844609

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.
Protein Families
MHC class I family
Tissue Specificity
Ubiquitous. Highly expressed in fetal extravillous trophoblasts in the decidua basalis (at protein level).
Database Links

HGNC: 4933

UNIGENE: Hs.656020

KEGG: hsa:3107

STRING: 9606.ENSP00000365402

OMIM: 142840

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products