Recombinant Human Fibroblast growth factor 3 (FGF3)

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
FGF3
Uniprot NO.
Alternative Names
FGF3; INT2Fibroblast growth factor 3; FGF-3; Heparin-binding growth factor 3; HBGF-3; Proto-oncogene Int-2
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
18-239
Target Protein Sequence
AAG PGARLRRDAG GRGGVYEHLG GAPRRRKLYC ATKYHLQLHP SGRVNGSLEN SAYSILEITA VEVGIVAIRG LFSGRYLAMN KRGRLYASEH YSAECEFVER IHELGYNTYA SRLYRTVSST PGARRQPSAE RLWYVSVNGK GRPRRGFKTR RTQKSSLFLP RVLDHRDHEM VRQLQSGLPR PPGKGVQPRR RRQKQSPDNL EPSHVQASRL GSQLEASAH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews
 Q&A
Q:

Regarding your protein CSB-EP008630HU, could you please advise on the lead time, the sequencing, the pricing, and the expected tag information?
Also, have any customers reported on this protein as being active?

A:
Thanks for your inquiry.
Expression Region: 18-239aa; Full length of the mature protein.
Tag information:Tag type will be determined during the manufacturing process.
The expected tag is N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

AAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH


Sorry, we didn't receive any feedback about the activity from other customers, and also haven't tested the activity, we can't 100% guarantee its activity.
However, as what we provide is the full length of the mature protein and we adpot affinity chromatography purification, it's purified under very mild condition, it should be active, we recommend you to purchase a small size to have a try.

Target Background

Function(From Uniprot)
Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal ear development.
Gene References into Functions
  1. FGFR1 and/or FGF3 gene amplification correlated with a lower pathologic complete response in patients with HER2(+) early breast cancer treated with neoadjuvant anti-HER2 therapy PMID:28381415
  2. fibroblast growth factor receptor 3 missense mutations were identified in 5 cases of thanatophoric dysplasia PMID:28249712
  3. MCF7 cells over-expressing both WNT1 and FGF3 show a 3.5-fold increase in mammosphere formation; conditioned media from these cells also promotes stem cell activity in untransfected parental MCF7 and T47D cells, as WNT1 and FGF3 are secreted factors. PMID:26421711
  4. analysis provided evidence for gene-gene interaction between FGF3 (rs4980700) and PAX9 (rs2073242), increasing risk for isolated oral clefts (p = 0.0003). FGF3 is associated with oral clefts and may interact with PAX9. PMID:24697712
  5. haplotypes may contribute to the tendon disease process in elite volleyball athletes PMID:24661680
  6. FGF3 gene expression is altered in a human breast cancer progression model. PMID:25333703
  7. Higher FGF-23 concentration was associated with LVED mass and with incident atrial fibrillation and may, in part, explain the link between chronic kidney disease and AF. PMID:24920722
  8. A de novo 290 kb interstitial duplication of chromosome 11q13.3 including the FGF3 and FGF4 genes. PMID:24120895
  9. tooth agenesis had increased risk of a family history of cancer. tooth agenesis was associated with positive self-reported family history of cancer and variants in FGF3. PMID:23169889
  10. This study is the first to show a significant association between coronary calcification and elevated serum FGF 23 in children. PMID:21359960
  11. confirm the absence of otodental syndrome in heterozygous FGF3 carriers, but report unilateral microtia in one of them PMID:21480479
  12. Manifestations of recessive FGF3 mutations range from fully penetrant LAMM syndrome to deafness with residual inner ear structures and, by extension, with minimal syndromic features. PMID:21306635
  13. alterations in dosage of the Fgf3 gene cause dental morphological changes PMID:20018768
  14. labyrinth aplasia, microtia, and microdontia (LAMM) syndrome, caused by mutations in FGF3 PMID:19950373
  15. These findings suggest that the nuclear form of FGF3 inhibits cell proliferation by interfering with ribosomal biogenesis. PMID:16263090
  16. Development of the inner ear is completely disturbed at a very early stage--or the otic vesicle is not induced at all--in all of the affected individuals who carried two mutant FGF3 alleles PMID:17236138
  17. FGF3, FGF7, FGF10, FGF18, and FGFR1 may have roles in nonsyndromic cleft lip and palate PMID:17360555
  18. Implication of FGF3 and FADD in human craniofacial disease. PMID:17656375
  19. sequenced the FGF3 gene in 10 unrelated families in which probands had congenital deafness associated with various inner ear anomalies, including Michel aplasia, with or without tooth or external ear anomalies. PMID:18435799
  20. study identified a homozygous missense mutation (c.196G-->T) in FGF3 in 21 affected individuals from a large extended family phenotypically characterized by autosomal recessive syndromic congenital sensorineural deafness, microtia and microdontia PMID:18701883
  21. Loss of FGFR3 signaling provides evidence that extracellular signals regulate not simply the proliferation or survival of radial glial cells, but specifically their progression to intermediate progenitor cells during neurogenesis in vivo. PMID:19923290

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Heparin-binding growth factors family
Database Links

HGNC: 3681

UNIGENE: Hs.37092

KEGG: hsa:2248

STRING: 9606.ENSP00000334122

OMIM: 164950

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1