| Code | |
| MSDS | |
| Size | Pls inquire |
| Source | |
| Conjugate | |
| Have Questions? | Leave a Message or Start an on-line Chat |
Regarding your protein CSB-EP008630HU, could you please advise on the lead time, the sequencing, the pricing, and the expected tag information?
Also, have any customers reported on this protein as being active?
AAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH
Email: support@cusabio.com
Distributors Worldwide