Recombinant Human Fatty acid synthase (FASN), partial

Code: CSB-EP008435HU1
Size:
20ug
20ug100ug1mg
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human FASN protein, partial
Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
FASN
Uniprot NO.
Research Area
Metabolism
Alternative Names
Type I fatty acid synthase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2200-2511aa
Target Protein Sequence
LACPTPKEDGLAQQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.2 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Fatty acid synthetase is a multifunctional enzyme that catalyzes the de novo biosynthesis of long-chain saturated fatty acids starting from acetyl-CoA and malonyl-CoA in the presence of NADPH. This multifunctional protein contains 7 catalytic activities and a site for the binding of the prosthetic group 4'-phosphopantetheine of the acyl carrier protein ([ACP]) domain.
Gene References into Functions
  1. Evaluation of FAS/FASL polymorphisms can predict lack of response to BCG immunotherapy and prevent the loss of valuable time before such alternative treatments as early cystectomy are initiated. PMID:29453645
  2. FASN-induced S6 kinase facilitates USP11-eIF4B complex formation for sustained oncogenic translation in diffuse large B-cell lymphoma. PMID:29483509
  3. HIV-1 infection increases intracellular levels of fatty acid synthase (FASN). Despite the requirement of FASN for nascent virion production, FASN activity was not required for intracellular Gag protein production, indicating that FASN dependent de novo fatty acid biosynthesis contributes to a late step of HIV-1 replication PMID:28962653
  4. Findings showed that FASN is upregulated in colorectal cancer cell lines that overexpress PGC-1alpha and indicated that FASN expression may enhance cancer cell proliferation by regulating antioxidant enzyme production and resistance to ROS-induced apoptosis. Further data provided evidence that FASN expression was regulated indirectly by PGC-1alpha. PMID:29130104
  5. Repression of FAS mRNA expression is the consequence of feedback inhibition of FAS expression by long chain fatty acyl-CoAs, which are formed by FACL3 during its upregulation by vitamin D3 in prostate cancer cells. PMID:15556626
  6. analysis of the expression of fatty acid synthase, Ki-67 and p53 in squamous cell carcinomas of the larynx PMID:18949744
  7. Fatty acid synthase (FASN) mRNA and protein overexpression were associated with unfavorable clinicopathologic factors and poor outcomes. PMID:28442505
  8. KRAS is associated with activation of ERK2, induction of FASN, and promotion of lipogenesis. PMID:28400509
  9. The study has shown that the high frequency of FASN expression in intraepithelial neoplasia (hPIN)and cancer and no expression in most structures of benign hyperplasia make it possible to use this protein as an additional marker in the differential diagnosis of prostatic neoplasms. PMID:28418352
  10. FASN inhibition/knockdown significantly increased the susceptibility of cisplatin-resistant cells to NK cell cytotoxicity. PMID:29306075
  11. FASN has a role in leucine deprivation-inhibited proliferation and apoptosis of human breast cancer cells PMID:27579768
  12. HER2-FASN lipogenic axis delineates a group of breast cancer patients that might benefit from treatment with therapeutic regimens containing FASN inhibitors PMID:27714708
  13. FASN expression is down-regulated by miR-15a and miR-16-1 in breast cancer cells, regulating cell proliferation. PMID:27713175
  14. These findings implicate Spot14 as a direct protein enhancer of FASN catalysis in the mammary gland during lactation when maximal MCFA production is needed. PMID:24771867
  15. High FASN expression is associated with prostate cancer growth. PMID:26934656
  16. We show that elevated levels of PPARG strongly correlate with elevation of FASN in human prostate cancer (CaP) and that high levels of PPARG/FASN and PI3K/pAKT pathway activation confer a poor prognosis.These data suggest that CaP patients could be stratified in terms of PPARG/FASN and PTEN levels to identify patients with aggressive CaP who may respond favorably to PPARG/FASN inhibition. PMID:27357679
  17. High FASN expression is associated with meningioma and schwannoma. PMID:28729415
  18. our findings show that microRNA-195 inhibits pancreatic cancer cell proliferation and invasion by regulating the fatty acid synthase/Wnt signaling pathway, suggesting a tumor suppressive role for microRNA-195 in the development and progression of pancreatic cancer. Thus, inhibiting fatty acid synthase by microRNA-195 may serve as a novel therapeutic approach for the treatment of pancreatic cancer. PMID:28639885
  19. Inhibition of FASN can decrease the levels of IGFBP1, and the expression, activity, and ubiquitination of HIF-1alpha. Inhibition of FASN can suppress migration, invasion and healing of hepatoma carcinoma cells by decreasing HIF-1alpha, and IGFBP1. PMID:28197637
  20. The involvement of SREBP-1c and ChREBP in FASN promoter histone modification.Histone acetylation affects FASN transcription by influencing ChREBP-binding carbohydrate-responsive elements. PMID:28027934
  21. Fatty acid synthase (FASN) inhibitors reduce proliferation and promote apoptosis in high FASN producers lymphatic endothelial cells (HDLEC) cells. PMID:27918556
  22. MACC1 and FASN are positively correlated and responsible for the poor prognoses in gastric cancer patients.FASN role in gastric cancer resistance to oxaliplatin. PMID:28339092
  23. Fatty acid synthase fine-tunes the cell's response to stress and injury by remodeling cellular O-GlcNAcylation PMID:28232487
  24. B7-H3 hijacks SREBP-1/FASN signaling mediating abnormal lipid metabolism in lung cancer PMID:27939887
  25. Uterine leiomyomata risk was positively associated with FASN AA genotype of SNP rs4247357 among the 7% of African American women with >40% European ancestry. PMID:27375065
  26. DNA methylation in HIF3A shares moderate correlation between adipose tissue and blood, and both are associated with BMI. In contrast, methylation in FASN is poorly correlated across tissues, but the DNA methylation in adipose tissue but not blood is highly associated with BMI PMID:26891033
  27. the present study provided evidence that miR320 may directly target fatty acid synthase. These results suggest that miR320 may serve as a therapeutic biomarker of NSCLC in the future. PMID:27277534
  28. increased expression of NF-YA may promote a malignant phenotype in OS cells via modulation of FASN expression. PMID:27840951
  29. Results suggest investigation of combined fatty acid synthase (FASN) inhibition and taxane treatment as a therapy for a variety of cancers. PMID:28159572
  30. our study suggests that miR12075p/FASN plays an important role in hepatocellular carcinoma PMID:27461404
  31. Our observations suggest a physiological role of placental FASN in human pregnancy. Future studies will clarify whether circulating FASN of placental origin does actually regulate placental and fetal growth PMID:27090298
  32. Results suggest that FASN plays a pivotal role in glioma neovascularization, and inhibition of FASN may be a potential target for anti-angiogenic therapy for glioma. PMID:27601165
  33. The role of FASN in breast cancer [review] PMID:26951539
  34. FASN, ErbB2-high-expressing SK-BR-3 cells displayed higher levels of glycolysis and migration than FASN, ErbB2-low-expressing MCF7 cells. PMID:26936618
  35. S-nitrosylation of FAS at normal physiological levels of NO increases its activity through dimerization and may contribute to the proper regulation of adipogenesis PMID:26851298
  36. concluded that EGFR can be activated intracellularly by FASN-dependent palmitoylation PMID:26378037
  37. Our results suggest that FASN upregulation and PTEN downregualtion may be involved in peritoneal dissemination for gastric cancer progression. PMID:26514456
  38. Data suggest that thioesterase 2 (TE2) catalytic domain of FASN exhibits novel capping domain insert within the alpha/beta hydrolase core; TE2 (as opposed to TE1 domain) readily releases short chain fatty acids from full-length FASN during turnover. PMID:26663084
  39. data demonstrate that selective and potent FASN inhibition with TVB-3166 leads to selective death of tumor cells, without significant effect on normal cells, and inhibits in vivo xenograft tumor growth at well-tolerated doses. PMID:26425687
  40. Results showed correlated FASN regulation relative to key signaling genes with tumor invasion and differentiation in primary retinoblastoma (RB) tissues. Its silencing exerted definite anti-cancer effects in RB cells through PI3K/AKT signaling pathway. PMID:25958981
  41. Findings indicate that overexpression of FASN plays a crucial role in maintaining energy homeostasis in CRC via increased oxidation of endogenously synthesized lipids. PMID:25970773
  42. TG levels are regulated by HCBP6-sterol regulatory element binding protein 1c (SREBP1c)-mediated fatty acid synthase (FASN) expression. PMID:25855506
  43. Loss of fatty acid synthase suppresses the malignant phenotype of colorectal cancer cells by down-regulating energy metabolism and mTOR signaling pathway. PMID:26109148
  44. In the present study it was determined whether three key enzymes for glycolysis, glutaminolysis and de novo synthesis of FAs, hexokinase-2, glutaminase and fatty acid synthase PMID:26134042
  45. FASN and HER2 have roles in breast cancer and are blocked by EGCG with pertuzumab or temsirolimus PMID:26107737
  46. Overall, no SNPs were associated with any known aggressiveness indicators. FASN staining intensity was stronger in malignant than in benign tissue, and NADT was associated with decreased FASN staining in both benign and malignant tissue PMID:25868764
  47. The results suggested that differential levels of P-glycoprotein, Caveolin-1 and Fatty acid synthase except CYP450 play a major role in acquired resistant phenotype in bladder cancer. PMID:26025399
  48. FASN inhibition induced apoptosis in chemosensitive and platinum-resistant ovarian cancer cells and may reverse cisplatin resistance. PMID:25947066
  49. These results for the first time indicated that a cross talk in FASN and HER2 expressions might be associated with prognosis in malignant ovarian cancer. PMID:25433947
  50. The results reveal that the cytotoxic effects of FASN inhibitors in sensitive lines may be due to the robust depletion of oncogenic signaling lipids, such as diacylglycerols and the elevation of tumor-suppressing ceramides. PMID:25871544

Show More

Hide All

Subcellular Location
Cytoplasm. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Tissue Specificity
Ubiquitous. Prominent expression in brain, lung, liver and mammary gland.
Database Links

HGNC: 3594

UNIGENE: Hs.83190

KEGG: hsa:2194

STRING: 9606.ENSP00000304592

OMIM: 600212

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products