Home
Product
Protein
Recombinant Proteins
Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial

Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial

CSB-YP890933HU

Rate （N/A）
Review （0）

Size:

20ug100ug1mg(1mg*1 or 500ug*2)

US$250

Quantity:

Express system: Yeast

Species: Homo sapiens (Human)

Tag Info: C-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Promotion

Transmembrane Protein Questionnaire with Gifts

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

ZNRF3

Uniprot NO.

Q9ULT6

Research Area

Epigenetics and Nuclear Signaling

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

56-219aa

Target Protein Sequence

KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM

Mol. Weight

19.7 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function

E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification.

Gene References into Functions

The present study suggests rs7290117 in ZNRF3 may be involved in the regulation of axial length, though our results do not support a contribution of the SNPs we tested in ZNRF3, HGF and MFRP to primary angle-closure glaucoma in northern Chinese people PMID:30348125
Missense variants of ZNRF3 are associated with Disorders of Sex Development. PMID:29735715
ZNRF3 inhibited the metastasis and tumorigenesis via suppressing the Wnt/beta-catenin signaling pathway in NPC cells. PMID:27733215
Data indicate that clinical specimens showed a significant inverse correlation between zinc and ring finger 3 (ZNRF3) and beta-catenin mRNA levels. PMID:27448298
miR-93/ZNRF3/Wnt/beta-catenin regulatory network contributes to the growth of lung carcinoma. PMID:26423400
ZnRF3 negatively influences both the Wnt and Hedgehog proliferative pathways, and probably this way it negatively regulates cancer progression. PMID:27352324
ZnRF3 negatively influences both the Wnt and Hedgehog proliferative pathways and probably this way it negatively regulates cancer progression PMID:25923840
Report shows that miR-146b participated in migration, invasion and chemoresistance in osteosarcoma via downregulation of ZNRF3. PMID:26549292
ZNRF3 binds RSPO1 and LGR5-RSPO1 with micromolar affinity via RSPO1 furin-like 1 (Fu1) domain. PMID:24349440
Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14 PMID:23670221
ZNRF3 inhibits gastric cancer cell growth and promotes cell apoptosis by affecting the Wnt/beta-catenin/TCF4 signalling pathway. PMID:23504200
study provides new mechanistic insights into the regulation of Wnt receptor turnover, and reveals ZNRF3 as a tractable target for therapeutic exploration PMID:22575959