Abbreviation
Recombinant Human ZNRF3 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ZNRF3 at 5 μg/mL can bind Human RSPO2 (CSB-MP751021HU1(M)), the EC50 is 5.091-6.991 ng/mL.
Alternative Names
(RING finger protein 203)(RING-type E3 ubiquitin transferase ZNRF3)(Zinc/RING finger protein 3)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
56-219aa
Target Protein Sequence
KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ZNRF3 at 5 μg/ml can bind Human RSPO2 (CSB-MP751021HU1(M)), the EC50 is 5.091-6.991 ng/mL.
Description
ZNRF3 functions as a critical negative regulator of Wnt signaling by targeting Frizzled receptors for ubiquitin-dependent degradation, making it a key node for studying Wnt pathway modulation. This recombinant human ZNRF3 partial construct (aa 56–219), expressed in mammalian cells with a C-terminal 6xHis tag, demonstrates confirmed binding to human RSPO2 with an EC50 of 5.091–6.991 ng/mL in functional ELISA, supporting its use as a positive control in ligand-binding assays, inhibitor screening for IC50 determination, and R-spondin interaction studies. The tag placement at the C-terminus preserves the extracellular domain architecture required for accurate kinetic parameter analysis and substrate specificity profiling. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this preparation meets the quality thresholds commonly required for cell-based Wnt signaling assays and drug candidate evaluation targeting the ZNRF3–RSPO interaction axis.
