Home
Product
Protein
Active Protein
Other
Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial (Active)

Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial (Active)

CSB-MP890933HU

Rate （N/A）
Review （0）

Size:

20ug100ug1mg

US$190

Quantity:

Express system: Mammalian cell

Species: Homo sapiens (Human)

Tag Info: C-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human ZNRF3 at 5 μg/mL can bind Human RSPO2 (CSB-MP751021HU1(M)), the EC₅₀ is 5.091-6.991 ng/mL.

Target Names

ZNRF3

Uniprot NO.

Q9ULT6

Alternative Names

(RING finger protein 203)(RING-type E3 ubiquitin transferase ZNRF3)(Zinc/RING finger protein 3)

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

56-219aa

Target Protein Sequence

KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM

Mol. Weight

20.4 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Storage

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Shelf Life

The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ZNRF3 at 5 μg/ml can bind Human RSPO2 (CSB-MP751021HU1(M)), the EC₅₀ is 5.091-6.991 ng/mL.

Description

The product was expressed with the C-terminal 6xHis-tagged human ZNRF3 gene fragment Lys56-Met219 in mammalian cells. Its purity is greater than 95%. Its activity and endotoxin have been determined.

ZNRF3 is a transmembrane E3 ubiquitin ligase acting as a negative regulator of the Wnt signaling pathway that targets Wnt receptors for ubiquitination and lysosomal degradation. Together with RNF43, ZNRF3 plays an important role in the development and tissue homeostasis by promoting the turnover of LPR6 and Frizzled (FZD). ZNRF3 and RNF43 are essential for embryonic patterning, sex determination, and limb morphogenesis. ZNRF3 is frequently inactivated in human cancers presenting as deletion or mutation to inhibit Wnt signaling. Loss of ZNRF3/RNF43 activity results in extensive cellular proliferation and metaplasia and has been related to EMT in many Wnt-associated malignancies.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function

E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification.

Gene References into Functions

The present study suggests rs7290117 in ZNRF3 may be involved in the regulation of axial length, though our results do not support a contribution of the SNPs we tested in ZNRF3, HGF and MFRP to primary angle-closure glaucoma in northern Chinese people PMID:30348125
Missense variants of ZNRF3 are associated with Disorders of Sex Development. PMID:29735715
ZNRF3 inhibited the metastasis and tumorigenesis via suppressing the Wnt/beta-catenin signaling pathway in NPC cells. PMID:27733215
Data indicate that clinical specimens showed a significant inverse correlation between zinc and ring finger 3 (ZNRF3) and beta-catenin mRNA levels. PMID:27448298
miR-93/ZNRF3/Wnt/beta-catenin regulatory network contributes to the growth of lung carcinoma. PMID:26423400
ZnRF3 negatively influences both the Wnt and Hedgehog proliferative pathways, and probably this way it negatively regulates cancer progression. PMID:27352324
ZnRF3 negatively influences both the Wnt and Hedgehog proliferative pathways and probably this way it negatively regulates cancer progression PMID:25923840
Report shows that miR-146b participated in migration, invasion and chemoresistance in osteosarcoma via downregulation of ZNRF3. PMID:26549292
ZNRF3 binds RSPO1 and LGR5-RSPO1 with micromolar affinity via RSPO1 furin-like 1 (Fu1) domain. PMID:24349440
Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14 PMID:23670221
ZNRF3 inhibits gastric cancer cell growth and promotes cell apoptosis by affecting the Wnt/beta-catenin/TCF4 signalling pathway. PMID:23504200
study provides new mechanistic insights into the regulation of Wnt receptor turnover, and reveals ZNRF3 as a tractable target for therapeutic exploration PMID:22575959