Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial (Active)

In Stock
Code: CSB-MP890933HU
Size:
20ug
20ug100ug1mg
US$190
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human ZNRF3 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ZNRF3 at 5 μg/mL can bind Human RSPO2 (CSB-MP751021HU1(M)), the EC50 is 5.091-6.991 ng/mL.
Target Names
ZNRF3
Uniprot NO.
Alternative Names
(RING finger protein 203)(RING-type E3 ubiquitin transferase ZNRF3)(Zinc/RING finger protein 3)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
56-219aa
Target Protein Sequence
KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.4 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human ZNRF3 at 5 μg/ml can bind Human RSPO2 (CSB-MP751021HU1(M)), the EC50 is 5.091-6.991 ng/mL.
Description

ZNRF3 functions as a critical negative regulator of Wnt signaling by targeting Frizzled receptors for ubiquitin-dependent degradation, making it a key node for studying Wnt pathway modulation. This recombinant human ZNRF3 partial construct (aa 56–219), expressed in mammalian cells with a C-terminal 6xHis tag, demonstrates confirmed binding to human RSPO2 with an EC50 of 5.091–6.991 ng/mL in functional ELISA, supporting its use as a positive control in ligand-binding assays, inhibitor screening for IC50 determination, and R-spondin interaction studies. The tag placement at the C-terminus preserves the extracellular domain architecture required for accurate kinetic parameter analysis and substrate specificity profiling. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this preparation meets the quality thresholds commonly required for cell-based Wnt signaling assays and drug candidate evaluation targeting the ZNRF3–RSPO interaction axis.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification.
Gene References into Functions
  1. The present study suggests rs7290117 in ZNRF3 may be involved in the regulation of axial length, though our results do not support a contribution of the SNPs we tested in ZNRF3, HGF and MFRP to primary angle-closure glaucoma in northern Chinese people PMID:30348125
  2. Missense variants of ZNRF3 are associated with Disorders of Sex Development. PMID:29735715
  3. ZNRF3 inhibited the metastasis and tumorigenesis via suppressing the Wnt/beta-catenin signaling pathway in NPC cells. PMID:27733215
  4. Data indicate that clinical specimens showed a significant inverse correlation between zinc and ring finger 3 (ZNRF3) and beta-catenin mRNA levels. PMID:27448298
  5. miR-93/ZNRF3/Wnt/beta-catenin regulatory network contributes to the growth of lung carcinoma. PMID:26423400
  6. ZnRF3 negatively influences both the Wnt and Hedgehog proliferative pathways, and probably this way it negatively regulates cancer progression. PMID:27352324
  7. ZnRF3 negatively influences both the Wnt and Hedgehog proliferative pathways and probably this way it negatively regulates cancer progression PMID:25923840
  8. Report shows that miR-146b participated in migration, invasion and chemoresistance in osteosarcoma via downregulation of ZNRF3. PMID:26549292
  9. ZNRF3 binds RSPO1 and LGR5-RSPO1 with micromolar affinity via RSPO1 furin-like 1 (Fu1) domain. PMID:24349440
  10. Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14 PMID:23670221
  11. ZNRF3 inhibits gastric cancer cell growth and promotes cell apoptosis by affecting the Wnt/beta-catenin/TCF4 signalling pathway. PMID:23504200
  12. study provides new mechanistic insights into the regulation of Wnt receptor turnover, and reveals ZNRF3 as a tractable target for therapeutic exploration PMID:22575959

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
ZNRF3 family
Database Links

HGNC: 18126

UNIGENE: Hs.604200

KEGG: hsa:84133

STRING: 9606.ENSP00000443824

OMIM: 612062

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products