Abbreviation
Recombinant Human CRLF2 protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human TSLP(CSB-MP025141HUh7) at 2 μg/mL can bind Human CRLF2 protein.The EC50 is 41.01-45.10 ng/mL.
Alternative Names
Cytokine receptor-like factor 2; Cytokine receptor-like 2; IL-XR; Thymic stromal lymphopoietin protein receptor (TSLP receptor); CRLF2; CRL2, ILXR, TSLPR
Species
Homo sapiens (Human)
Expression Region
25-231aa
Target Protein Sequence
GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human TSLP(CSB-MP025141HUh7) at 2 μg/ml can bind Human CRLF2 protein.The EC50 is 41.01-45.10 ng/mL.
-
The purity of CRLF2 was greater than 95% as determined by SEC-HPLC
Description
CRLF2 forms a heterodimeric receptor complex with IL-7Rα to mediate thymic stromal lymphopoietin (TSLP) signaling, a pathway central to allergic inflammation and lymphoid development. This mammalian-expressed construct spanning residues 25–231 captures the complete extracellular ligand-binding domain and demonstrates quantified binding to human TSLP with an EC50 of 41.01–45.10 ng/mL in functional ELISA, providing a validated reagent for ligand-receptor interaction studies and competitive inhibition assays. The native post-translational modifications conferred by mammalian expression support conformational integrity critical for epitope mapping of therapeutic antibodies targeting the TSLP–CRLF2 axis, as well as for screening biologics or small-molecule inhibitors in drug discovery campaigns. With purity exceeding 95% by SEC-HPLC and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for surface plasmon resonance affinity characterization, biolayer interferometry kinetics studies, and use as a positive control in receptor-binding platforms.
