Abbreviation
Recombinant Human CRLF2 protein, partial, Biotinylated (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human CRLF2 at 2 μg/mL on streptavidin coated plates can bind Anti-CRLF2 recombinant antibody(CSB-RA005983MA1HU). The EC50 is 3.631-7.668 ng/mL.
Alternative Names
Cytokine receptor-like factor 2; Cytokine receptor-like 2; IL-XR; Thymic stromal lymphopoietin protein receptor (TSLP receptor); CRLF2; CRL2, ILXR, TSLPR
Species
Homo sapiens (Human)
Expression Region
25-231aa
Target Protein Sequence
GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-Avi-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human CRLF2 at 2 μg/ml on streptavidin coated plates can bind Anti-CRLF2 recombinant antibody(CSB-RA005983MA1HU). The EC50 is 3.631-7.668 ng/mL.
Description
CRLF2 forms a heterodimeric receptor complex with IL-7Rα to mediate thymic stromal lymphopoietin (TSLP) signaling, a pathway implicated in allergic inflammation and certain B-cell acute lymphoblastic leukemias. This biotinylated extracellular domain (aa 25–231) is expressed in mammalian cells to preserve native glycosylation and disulfide architecture, yielding a protein that demonstrates quantifiable antibody binding in functional ELISA with an EC50 of 3.631–7.668 ng/mL when immobilized on streptavidin-coated surfaces. The streptavidin-compatible biotin tag enables oriented capture in surface plasmon resonance and biolayer interferometry experiments for affinity characterization of therapeutic antibody candidates targeting CRLF2, as well as competitive inhibition assays to screen blocking antibodies or TSLP antagonists. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in antibody epitope mapping and ligand-receptor interaction studies where low background and minimal inflammatory artifacts are essential.
