Recombinant Human Cyclin-dependent kinase4 (CDK4)

Code: CSB-BP005065HU
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$400
Quantity:
Express system: Baculovirus
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CDK4
Uniprot NO.
Research Area
Cancer
Alternative Names
Cdk 4; cdk4; CDK4 protein; CDK4_HUMAN; Cell division kinase 4; Cell division protein kinase 4; CMM 3; CMM3; Crk3; Cyclin dependent kinase 4; Cyclin-dependent kinase 4; Melanoma cutaneous malignant 3; MGC14458; p34 cdk4; PSK J3; PSK-J3
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
2-303aa
Target Protein Sequence
ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

The recombinant human CDK4 protein with an N-terminal 6xHis tag is expressed using a baculovirus expression system. The CDK4 gene fragment (2-303aa) is co-integrated into a vector with the 6xHis tag gene and then transformed into baculovirus. The baculovirus is cultured for protein expression by using IPTG. The recombinant CDK4 protein is isolated and purified by Ni-NTA affinity chromatography from the cell culture supernatant. The protein is analyzed by SDS-PAGE to determine purity, reaching up to 90%.

Human CDK4 is a crucial regulatory protein that plays a significant role in cell cycle progression, particularly in the transition from the G1 phase to the S phase. CDK4 functions by forming a complex with D-type cyclins, which is essential for its kinase activity. This interaction is tightly regulated by cyclin-dependent kinase inhibitors (CKIs) such as p16INK4a, which inhibit CDK4 activity and thereby control cell proliferation [1][2][3]. The phosphorylation of CDK4 at Thr172 is particularly important for its activation, allowing CDK4 to engage with cyclins effectively, thus promoting cell cycle progression [2][4].

The dysregulation of CDK4 is frequently observed in various cancers, where it contributes to unchecked cellular proliferation. Hyperactivation of the CDK4 pathway has been implicated in breast cancer, where elevated levels of cyclin D1 and CDK4 lead to enhanced tumor growth [5][6][7]. Furthermore, the presence of mutations in CDK4, such as R24C and R24H, has been associated with certain malignancies, although these mutations are not commonly found in sporadic endocrine tumors [1][4].

References:
[1] V. Vax, R. Bibi, S. Díaz‐Cano, M. Gueorguiev, B. Kola, N. Borboli, et al. Activating point mutations in cyclin-dependent kinase 4 are not seen in sporadic pituitary adenomas, insulinomas or leydig cell tumours, Journal of Endocrinology, vol. 178, no. 2, p. 301-310, 2003. https://doi.org/10.1677/joe.0.1780301
[2] L. Bockstaele, H. Kooken, F. Libert, S. Paternot, J. Dumont, Y. Launoit, et al. Regulated activating thr172 phosphorylation of cyclin-dependent kinase 4(cdk4): its relationship with cyclins and cdk “inhibitors”, Molecular and Cellular Biology, vol. 26, no. 13, p. 5070-5085, 2006. https://doi.org/10.1128/mcb.02006-05
[3] P. Roberts, J. Bisi, J. Strum, A. Combest, D. Darr, J. Usary, et al. Multiple roles of cyclin-dependent kinase 4/6 inhibitors in cancer therapy, Jnci Journal of the National Cancer Institute, vol. 104, no. 6, p. 476-487, 2012. https://doi.org/10.1093/jnci/djs002
[4] H. Yang, X. Zhao, L. Zhao, L. Liu, J. Li, W. Jia, et al. Prmt5 competitively binds to cdk4 to promote g1-s transition upon glucose induction in hepatocellular carcinoma, Oncotarget, vol. 7, no. 44, p. 72131-72147, 2016. https://doi.org/10.18632/oncotarget.12351
[5] E. Peurala, P. Koivunen, K. Haapasaari, R. Bloigu, & A. Jukkola-Vuorinen, The prognostic significance and value of cyclin d1, cdk4 and p16 in human breast cancer, Breast Cancer Research, vol. 15, no. 1, 2013. https://doi.org/10.1186/bcr3376
[6] Q. Yu, E. Sicińska, Y. Geng, M. Ahnström, A. Zagożdżon, Y. Kong, et al. Requirement for cdk4 kinase function in breast cancer, Cancer Cell, vol. 9, no. 1, p. 23-32, 2006. https://doi.org/10.1016/j.ccr.2005.12.012
[7] Y. Sun, D. Luo, & D. Liao, Cyclind1 protein plays different roles in modulating chemoresponses in mcf7 and mda-mb231 cells, Journal of Carcinogenesis, vol. 11, no. 1, p. 12, 2012. https://doi.org/10.4103/1477-3163.100401

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complexes and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also phosphorylates SMAD3 in a cell-cycle-dependent manner and represses its transcriptional activity. Component of the ternary complex, cyclin D/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex.
Gene References into Functions
  1. Data indicate that PAQR4 has a tumorigenic effect on human breast cancers, and such effect is associated with a modulatory activity of PAQR4 on protein degradation of CDK4 PMID:29228296
  2. MiR-340 overexpression inhibited tumor growth by regulating CDK4 expression. miR-340 functions as a tumor suppressor in non small cell lung cancer (NSCLC) cells and may provide a potential target of NSCLC treatment. PMID:29935356
  3. CDK4 and XPO1 are not altered in a rare undifferentiated sarcoma, making them therapeutic targets PMID:27329820
  4. while mTOR inhibitors restore endocrine sensitivity, CDK4/6 inhibitors may favor the emergence of estrogen receptor 1 (ESR1) mutations resulting in ligand-independent activity of the receptor PMID:28685610
  5. Inhibition of CDK4/6 is potentially a highly effective strategy for the treatment of SHH and MYC-amplified group 3 medulloblastoma. PMID:28637687
  6. SOX12 can increase the expression of CDK4 and IGF2BP1, which confer malignant phenotypes to Hepatocellular Carcinoma. PMID:28975985
  7. Study showed that CDK4 and BCAS2 may be target genes of miR-486 and levels of CDK4 and BCAS2 were both significantly higher in the esophageal cancer tissues and cell lines than levels in the normal tissues and cells. PMID:29115564
  8. blocking CDK4 activity efficiently eliminated both normal and chemotherapy-resistant cancer cells in triple negative breast cancers, highlighting CDK4 as a promising novel therapeutic target for these aggressive breast tumors. PMID:27759034
  9. Amplification of gene CDK4 is associated with lung adenocarcinoma. PMID:28381877
  10. Ongoing trials of doublet and triplet targeted therapies containing ribociclib seek to identify optimal CDK4/6-based targeted combination regimens for various tumor types and advance the field of precision therapeutics in oncology PMID:28351928
  11. Palbociclib induces activation of AMPK and inhibits hepatocellular carcinoma in a CDK4/6-independent manner PMID:28453226
  12. The combination of ribociclib, a dual inhibitor of cyclin-dependent kinase (CDK) 4 and 6, and the ALK inhibitor ceritinib demonstrated higher cytotoxicity and synergy scores (P = 0.006) in cell lines with ALK mutations as compared with cell lines lacking mutations or alterations in ALK . PMID:27986745
  13. Results showed that CDK4 expression was up-regulated in colorectal carcinoma and suggested that cdc37 increased the stability of CDK4 to activate RB1 which ultimately promotes G1-S transition. PMID:29288563
  14. Data show that sulfatase 1 (hSulf-1) overexpression in melanoma cells can inhibit cell proliferation and induce cell cycle arrest and apoptosis by decreasing the protein kinase B (AKT) phosphorylation and limiting cyclin dependent kinase 4 (CDK4) nuclear import. PMID:27806323
  15. we here show that subgroups of SDCs display genomic amplifications of MDM2 and/or CDK4, partly in association with TP53 mutations and rearrangement/amplification of HMGA2. PMID:27662657
  16. CDK4/6 inhibition suppressed cell cycle progression of ER+/HER2- brreast cancer models. PMID:27564114
  17. Proliferating tumor stem cells with high telomerase expression are suitable targets for CDK4/6 inhibitor, palbociclib. PMID:28039467
  18. PRMT5 inhibited the interaction between CDK4 and CDKN2A and then activated the CDK4-RB-E2F pathway in hepatocellular carcinoma cells under glucose induction. PMID:27708221
  19. This is the first clinical study exploring the use of a CDK4/6 inhibitor in a pediatric population. In this phase I study, we established the maximum tolerated dose (MTD) and recommended phase II dose (RP2D) of single-agent ribociclib in pediatric patients with neuroblastoma, MRTs, or other cancers with documented cyclin D-CDK4/6-INK4-retinoblastoma pathway aberrations PMID:28432176
  20. Ribociclib (an oral, highly specific cyclin-dependent kinase 4/6 inhibitor) inhibits tumor growth. PMID:27542767
  21. network-based rigidity analysis and emulation of thermal unfolding of the Cdk4-cyclin D complex and Hsp90-Cdc37-Cdk4 complex revealed weak spots of kinase instability that are present in the native Cdk4 structure and are targeted by the chaperone during client recruitment PMID:29267381
  22. The study of 140 cases confirms that the incidence of MDM2/CDK4 amplification is low (5%) in large and/or deep-seated (subfascial) lipomatous neoplasms with histological features of a lipoma (or lipoma variant). PMID:27020493
  23. miR-486-5p inhibits non-small cell lung cancer progression by down-regulating the expression of CDK4. PMID:27049724
  24. Combined PI3Kalpha and CDK4/6 inhibition significantly improved disease control in human xenograft models compared with either monotherapy. PMID:28947417
  25. High amplification levels of CDK4 is associated with dedifferentiated liposarcoma. PMID:29153098
  26. Activation of cdk4 triggers NAFLD. PMID:27373160
  27. Our results show that combined exogenous expression of hTERT and mutant CDK4 is an effective method to generate single-cell-derived Cancer-associated fibroblasts (CAFs) clones. This provides an innovative and suitable approach to investigate the heterogeneous function and phenotype of CAFs PMID:28364361
  28. these findings support that PIKE amplification or overexpression coordinately acts with CDK4 to drive glioblastoma tumorigenesis. PMID:28368413
  29. Specific E2Fs also have prognostic value in breast cancer, independent of clinical parameters. We discuss here recent advances in understanding of the RB-E2F pathway in breast cancer. We also discuss the application of genome-wide genetic screening efforts to gain insight into synthetic lethal interactions of CDK4/6 inhibitors in breast cancer for the development of more effective combination therapies. PMID:26923330
  30. p16 in combination with MDM2 and CDK4 immunohistochemistry may help in the differential diagnosis of atypical lipomatous tumor/well-differentiated liposarcoma and dedifferentiated liposarcoma. PMID:27597521
  31. conclude that p16 is highly sensitive for retroperitoneal DDL. However, the lack of specificity limits the diagnostic utility compared with the more established markers MDM2 and CDK4 PMID:26509911
  32. CDK4 overexpression is associated with cancer. PMID:27206849
  33. High CDK4 expression is associated with Melanoma. PMID:26988987
  34. Staining for MDM2 and CDK4 was noted in 25/56 and 23/56 atypical lipomatous tumor/well-differentiated liposarcoma (ALT/WDL), respectively, giving a sensitivity of 45% and 41% and a specificity of 98% and 92%. Staining was noted exclusively in the nuclei of atypical cells and not in the nuclei of adipocytes. Staining for MDM2 and CDK4 occurred in 2/125 and 10/117 benign lipomatous lesions, respectively. PMID:27508976
  35. Cdk4 inhibition leads to directing human mesenchymal stem cells to a multipotent neurogenic fate by inactivating Smads-STAT3 signaling. PMID:27192561
  36. Reduced SIRT2 expression during tumorigenesis failed to repress cyclindependent kinase 4 expression, which eventually led to accelerated cell proliferation. PMID:28259910
  37. older patients with head and neck squamous cell carcinoma and lung cancer have raised serums CDK4 levels, which has the potential to emerge as a biomarker in clinical practice PMID:27815686
  38. we illustrate that the miR-124/CDK4 axis plays an important role in radiation sensitivity of human esophageal cancer cells by targeting CDK4. PMID:27323123
  39. MiR-16 upregulation could reduce CDK4 expression. PMID:26383521
  40. both miR-613 mimics and inhibitors could decrease and increase CDK4 protein levels in non-small cell lung cancer-derived cells, respectively. PMID:26744345
  41. Upregulation of CDK4 expression is associated with gastric cancer. PMID:26735582
  42. Our studies demonstrate that CDK4 and miR-15a comprise an abnormal automodulatory feedback loop stimulating the pathogenesis and inducing chemotherapy resistance in nasopharyngeal carcinoma . PMID:26993269
  43. miR-539 plays an important role in the initiation and progression of nasopharyngeal carcinoma by targeting CDK4. PMID:26559153
  44. The concept that cotargeting MEK and CDK4/6 would prove efficacious in KRAS-mutant (KRAS(mt)) colorectal cancers. PMID:26369631
  45. This review highlights our current understanding of CDK signaling in both normal and malignant breast tissues, with special attention placed on recent clinical advances in inhibition of CDK4/6 in ER+ disease PMID:26857361
  46. concurrent inhibition of ESR1 and the cyclin-dependent kinases 4 and 6 (CDK4/6) significantly increased progression-free survival in advanced patients PMID:25991817
  47. amplification of HMGA2 was associated with the atypical lipomatous tumor/well-differentiated liposarcoma histological type and a good prognosis, whereas CDK4 and JUN amplifications were associated with dedifferentiated liposarcoma histology PMID:26336885
  48. CDK4 Amplification Reduces Sensitivity to CDK4/6 Inhibition in Fusion-Positive Rhabdomyosarcoma PMID:25810375
  49. Observations disclose the presence of CDK4 protein in human erythrocytes and its involvement in suicidal erythrocyte death. PMID:26418250
  50. Data show that the p16/CDKN2A-cyclin-dependent kinase 4 (CDK4)-RB1 protein pathway is frequently disrupted in fibrosarcomatous dermatofibrosarcoma protuberans (FS-DFSP). PMID:25852058

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Nucleus membrane.
Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
Database Links

HGNC: 1773

UNIGENE: Hs.95577

KEGG: hsa:1019

STRING: 9606.ENSP00000257904

OMIM: 123829

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products