Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial

Code: CSB-BP882147HU
Size:
20ug
20ug100ug1mg
US$352
Quantity:
Express system: Homo sapiens (Human)
Species: Homo sapiens (Human)
Tag Info: N-terminal GST-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human CDK12 protein, partial
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
CDK12
Uniprot NO.
Research Area
Signal Transduction
Alternative Names
Cdc2-related kinase, arginine/serine-rich;Cell division cycle 2-related protein kinase 7;Cell division protein kinase 12
Species
Homo sapiens (Human)
Source
Homo sapiens (Human)
Expression Region
727-1020aa
Target Protein Sequence
FDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
64
Protein Length
Partial
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Cyclin-dependent kinase that phosphorylates the C-terminal domain (CTD) of the large subunit of RNA polymerase II (POLR2A), thereby acting as a key regulator of transcription elongation. Regulates the expression of genes involved in DNA repair and is required for the maintenance of genomic stability. Preferentially phosphorylates 'Ser-5' in CTD repeats that are already phosphorylated at 'Ser-7', but can also phosphorylate 'Ser-2'. Required for RNA splicing, possibly by phosphorylating SRSF1/SF2. Involved in regulation of MAP kinase activity, possibly leading to affect the response to estrogen inhibitors.
Gene References into Functions
  1. Cyclin K expression positively correlates with cell proliferation; knockdown of cyclin K or its cognate kinase CDK12 prevents the assembly of prereplicative complex in the G1 cell cycle phase. PMID:29760377
  2. CDK12 regulates prereplicative complex assembly to promote mammalian cell proliferation. PMID:29760377
  3. CDK12 gene amplification can contribute to the pathogenesis of breast cancer. PMID:28334900
  4. BRCA1 downregulation combined with CHK1 inhibition induced excessive amounts of DNA damage, resulting in an inability to complete the S-phase. Therefore, we suggest CHK1 inhibition as a strategy for targeting BRCA1- or CDK12-deficient tumors. PMID:29025359
  5. In Ovarian Cancer patients CDK12 loss is consistently associated with a particular genomic instability pattern characterized by hundreds of tandem duplications PMID:26787835
  6. Structures of CDK12/CycK complexes solved in the presence of AMP-PNP. PMID:26597175
  7. Data show that most mutations prevent formation of the cyclin-dependent kinase 12 (Cdk12)/cyclin K (CycK) complex, rendering the kinase inactive. PMID:25712099
  8. CDK12 affects RNA processing events in two distinct ways: Indirectly through generating factor-binding phospho-epitopes on the CTD of elongating RNAPII and directly through binding to specific factors PMID:25429106
  9. CDK12 and CDK13 losses in HCT116 cells preferentially affect expression of DNA damage response. PMID:25561469
  10. CDK12 plays an important role in cotranscriptional processing of c-FOS transcripts PMID:25384976
  11. CDK12 has properties that should confirm interest in its use as a biomarker. PMID:24240700
  12. many CDK12 mutations are an unrecognized cause of HR defects in ovarian cancers PMID:24554720
  13. CDK12 interacts with cyclin K and is required to maintain embryonnic stem cell self-renewal. PMID:22547058
  14. Cyclin K1 is the primary cyclin partner for CDK12/CrkRS and it is required for activation of CDK12/CrkRS to phosphorylate the C-terminal domain of RNA Pol II. PMID:22988298
  15. through regulation of expression of DNA damage response genes, CycK/Cdk12 protects cells from genomic instability PMID:22012619
  16. Data show that siRNA knockdown of hCDK12 in HeLa cells results in alterations in the CTD phosphorylation state. PMID:20952539
  17. CRK7 modifies MAP kinases regulation and resistance to estrogen signaling inhibitors in breast cancers. PMID:19651820

Show More

Hide All

Subcellular Location
Nucleus. Nucleus speckle. Note=Colocalized with nuclear speckles throughout interphase.
Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
Tissue Specificity
Ubiquitously expressed.
Database Links

HGNC: 24224

UNIGENE: Hs.345028

KEGG: hsa:51755

STRING: 9606.ENSP00000398880

OMIM: 615514

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products