Recombinant Human Cell surface glycoprotein CD200 receptor 1 (CD200R1), partial

Code: CSB-EP851547HU1
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$306
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-KSI-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
CD200R1
Uniprot NO.
Research Area
Cardiovascular
Alternative Names
CD200 cell surface glycoprotein receptor;Cell surface glycoprotein OX2 receptor 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
226-325aa
Target Protein Sequence
SLYIELLPVPGAKKSAKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKTESTPVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.7 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-KSI-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Inhibitory receptor for the CD200/OX2 cell surface glycoprotein. Limits inflammation by inhibiting the expression of proinflammatory molecules including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS) in response to selected stimuli. Also binds to HHV-8 K14 viral CD200 homolog with identical affinity and kinetics as the host CD200.
Gene References into Functions
  1. Reduced expression of monocyte CD200R is associated with enhanced proinflammatory cytokine production in sarcoidosis PMID:27929051
  2. we demonstrated for the first time that CD200R is highly expressed on cells involved in type 2 immune responses, namely on Th2, Tc2, ILC2, and basophils. All these cell types play a role in type 2 inflammation. PMID:28106273
  3. Residual CD200 activity may prevent completion of abortions via induction of Treg cells. In chronic histiocytic intervillositis, infiltrating maternal effector T cells may block Treg induction. An autocrine role for CD200-CD200R interaction versus inhibition of soluble CD200 by soluble CD200R is discussed. PMID:28326648
  4. MMP12-producing monocyte-derived cells in gingival tissue of periodontitis patients also had reduced CD200R surface levels. Treatment with a CD200R ligand reduced CSF2-induced MMP12 production in these cells. This novel association of the CD200/CD200R pathway with MMP12 production by monocyte-derived cells may play a key role in PD progression. PMID:29101312
  5. Coexpression of CD200R-CD28 enhances function in WT1-specific T-cell receptor - transduced human primary T cells. PMID:29042364
  6. Our findings suggest a promising role of CD200R as a prognostic marker in predicting elevated recurrence and reduced survival, and a potential therapeutic target in treating hepatocellular carcinoma. PMID:27562325
  7. we revealed a critical role for CD200R signaling in limiting the growth and metastasis of CD200(+) tumors. PMID:27385779
  8. Constitutively expressed Siglec-9 inhibits LPS-induced CCR7, but enhances IL-4-induced CD200R expression in human macrophages. PMID:26923638
  9. Inflammatory Bowel Disease patients showed a significant decrease in the percentage of plasmacytoid dendritic cells and myeloid dendritic cells expressing CD200R1 compared to that of the control group. PMID:26690123
  10. CD200-CD200R1 signaling may be required for human pregnancy success. PMID:26123445
  11. This is the first report of CD200R1 expression by human epithelial tumor cells, and specifically, early-stage human breast cancer cells. It is also the first report of CD200R1 expression by term placental villous trophoblasts. PMID:26011475
  12. data show that the expression of CD200R, CD95 and CD95L was influenced by cardiac surgery and imply the role of these membrane molecules in cell regulation-inhibition and apoptosis following cardiac surgery. PMID:25404054
  13. The authors showed that the viral orthologues e127 from rat cytomegalovirus and K14 from human herpesvirus 8 do not bind the activating CD200R-like proteins from their respective species, although they do bind the inhibitory receptors. PMID:26538068
  14. The proportion of CD200R1+ cells in PBMCs, peripheral CD14+ cells and CD4+ T cells was significantly lower in rheumatoid arthritis patients compared to controls. PMID:25261692
  15. We demonstrate a significant correlation between CD200R1 positive cells and disease severity in rheumatoid arthritis (RA) patients, thus indicating the relevance of the CD200/CD200R1 signaling pathway potential involvement in the pathogenesis of RA. PMID:24496593
  16. The mechanism underlying ESA might be associated with enhanced expression of CD200 and CD200R in the trophoblast, leading to an upregulation of the immune response during the first trimester of pregnancy. PMID:25145957
  17. The expression of CD200R as well as B7-H4 co-stimulatory molecules on CD14(+) cells were significantly higher in cord blood when compared with peripheral blood. PMID:23066977
  18. Measurement of sCD200 and/or sCD200R1 may prove a useful and rapid means of monitoring subjects at risk of bone loss. PMID:24333170
  19. [review] CD200R1 is comparable to other pathogen-targeted inhibitory receptors; its signaling pathway is utilized by a diverse number of pathogens and represents a novel targeting strategy for infectiouis diseases. PMID:24388216
  20. Mesenchymal stem cells, through the expression of CD200, play a major role in the regulation of bone resorption and bone physiology and the CD200-CD200R couple could be a new target to control bone diseases. PMID:23940819
  21. The expression of CD200 and its receptor, CD200R, on CD83+ monocyte-derived dendritic cells (Mo-DCs), pulsed or not with autologous tumor cell lysates (aTCL) in patients who suffer from laryngeal carcinoma, were examined. PMID:23690219
  22. blocking CD200 on tumor cells may have opposite effects on tumor proliferation depending on the "affinity" of the macrophages to form the CD200-CD200R-complex with tumor cells. PMID:23541619
  23. CD200 and CD200R1 expression and function are abnormal in systemic lupus erythematosus PMID:22621248
  24. in cutaneous squamous cell carcinoma, CD200 expression on local blood vessels may promote tumor progression by suppressing CD200R myeloid cells during diapedesis PMID:23560298
  25. Mesenchymal stromal cells are able to modulate the expression of both CD200 and CD200R on some T-cells. PMID:22575528
  26. these results indicate a role of CD200R:CD200 in T cell responses to helminths which has diagnostic and prognostic relevance as a marker of infection for chronic schistosomiasis in mouse and man. PMID:22496920
  27. Mechanistically, Kaposi's sarcoma-associated herpesvirus viral OX2 protein and CD200 expression on antigen presenting cells suppressed the phosphorylation of ERK1/2 mitogen-activated protein kinase in responding T cells. PMID:22491458
  28. The role of the CD200-CD200R axis in bone marrow-derived mesenchymal stem cell mediated immunosuppression was studied using THP-1 human macrophages. PMID:22363701
  29. Dok1 negatively regulates Dok2-mediated CD200R signaling through the recruitment of CrkL. PMID:21078907
  30. results suggest an intrinsic abnormality in the CD200-CD200R signaling in monocyte-derived macrophages during aging and, especially, in Parkinson disease PMID:19924532
  31. The CD200 receptor gene family resembles the signal regulatory proteins and killer Ig-related receptors in having receptor family members with potential activatory and inhibitory functions that may play important roles in immune regulation and balance. PMID:12960329
  32. Human Herpesvirus-8 K14 protein interacts with human CD200R during the lytic cycle. Despite sharing only 40% primary sequence identity, K14 and CD200 interacts with CD200R with an almost identical and low affinity (K(D) = 0.5 microM) PMID:15220441
  33. CD200R represents a novel and potent inhibitory receptor that can be targeted in vivo to regulate mast cell-dependent pathologies. PMID:15661892
  34. Human CD200R is an important regulatory molecule of basophil activation. PMID:16177086
  35. Reactions with CD200 antigen modulate immunomodulation for prevention of undesired immune responses of the skin. PMID:16354172
  36. In human tonsils, CD200R is differentially expressed on B cells, with high expression on memory cells and plasmablasts. PMID:17714785
  37. Review highlights the close correlation between CD200-CD200 receptor (CD200R), microglia activation, and Parkinson's disease. PMID:18040859
  38. The CD200-CD200R pathway seems of critical relevance for macrophage-mediated damage in autoimmune inflammation of the CNS. PMID:18164423
  39. CD200-mediated immune suppression may occur not only via neuron-microglia interactions, but also via glia-glia interactions, especially in inflammatory conditions in which an immune-suppressive environment needs to be restored. PMID:19151626
  40. CD200R inhibits the activation of human myeloid cells through direct recruitment of Dok2 and subsequent activation of RAS p21 protein activator 1. PMID:19786546

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 4]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Isoform 3]: Secreted.
Protein Families
CD200R family
Tissue Specificity
Expressed in granulocytes, monocytes, most T-cells, neutrophils, basophils and a subset of NK, NKT and B-cells (at protein level). Expressed in bone marrow, lymph nodes, spleen, lung, liver, spinal cord, kidney. Expressed in monocyte-derived dendritic and
Database Links

HGNC: 24235

UNIGENE: Hs.309158

KEGG: hsa:131450

OMIM: 607546

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products