Recombinant Human CD59 glycoprotein (CD59)

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
CD59
Uniprot NO.
Research Area
Cardiovascular
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
26-102aa
Target Protein Sequence
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.; The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes.
Gene References into Functions
  1. Parainfluenza Virus 5 (PIV5) containing CD59 antigens (PIV5-CD59) shows increased resistance to complement-mediated neutralization in vitro comparing to PIV5 lacking regulators. Infection of A549 cells with PIV5 upregulates CD59 expression. TGF-beta treatment of PIV5-infected cells also increases cell surface CD59 expression and progeny virions are more resistant to complement-mediated neutralization. PMID:29693588
  2. Nonfunctioning CD59 is a major risk factor for stroke and hypercoagulability. PMID:29929138
  3. Therapeutic strategies that seek to modulate the functions of CD59 in the tumor microenvironment could be a promising direction for tumor immunotherapy. PMID:29521526
  4. This study demonstrated that Diffuse microvascular C5b-9 deposition is a common feature in muscle and nerve biopsies from diabetic patients. PMID:29458425
  5. Movement of Domain 2 with respect to Domain 3 of ILY is essential for forming a late prepore intermediate that releases CD59, while the role of cholesterol may be limited to insertion of the transmembrane segments. Together these data define a structural timeline for ILY pore formation and suggest a mechanism that is relevant to understanding other pore-forming toxins that also require CD59. PMID:27910935
  6. CD59 polymorphisms are associated with gene expression and different sexual susceptibility to pemphigus foliaceus in the Brazilian patients. PMID:28534443
  7. we demonstrated that CD59 regulation by SOX2 is required for stem cell evasion of complement surveillance. This finding highlights the importance of complement surveillance in eliminating CSCs and may suggest CD59 as a potential target for cancer therapy. PMID:28017655
  8. The results indicate that shear stress is an important mediator in endothelial progenitor cells expression of CD59 regulated by the extacellular matrix-integrin alphaVbeta3-F-actin pathway, which is a key factor in preventing membrane attack complex-mediated cell autolysis. PMID:28943429
  9. Data show that following 4 patients with CD59 Cys89Tyr mutations who are treated with eculizumab, no strokes occurred and non-permanent neurological insults underwent resolution without any new neurological exacerbations. PMID:28622911
  10. our results indicate that the Lys(41) /His(44) glycation motif in human CD59 may confer humans a higher risk of developing vascular disease in response to hyperglycemia. PMID:28815695
  11. Structural basis for receptor recognition by the human CD59-responsive cholesterol-dependent cytolysins has been presented. PMID:27499440
  12. developed a model of conditional and targeted cell ablation by generating floxed STOP-CD59 knockin mice (ihCD59), in which expression of human CD59 only occurs after Cre-mediated recombination PMID:27159394
  13. Our results revealed that SNPs CD59-rs831626 and CFH-rs1065489 were associated with the susceptibility of acute anterior uveitis. PMID:27419833
  14. Novel disorder caused by CD59 deficiency or nonfunctional CD59 at the cell membrane presenting with symptoms characteristic of classical GBS or CIDP. PMID:27568864
  15. Single-fluorescent-molecule imaging in the live-cell plasma membrane revealed the clear but transient colocalization and codiffusion of fluorescent ganglioside analogs with a fluorescently labeled glycosylphosphatidylinisotol (GPI)-anchored protein, human CD59, with lifetimes of 12 ms for CD59 monomers, 40 ms for CD59's transient homodimer rafts in quiescent cells. PMID:27043189
  16. There is an altered pattern of CD55 and CD59 expression on RBCs of SCD Patients; however, it does not seem to play a causal role in the pathophysiology of anemia, and is unlikely to be influenced by the level of erythropoietin or other inflammatory mediators. PMID:27667587
  17. Study revealed that CD59 is overexpressed in breast cancer tumors and correlates with poor survival. PMID:26935178
  18. A Promoter Polymorphism in the CD59 Gene in Donor Lungs Correlates With a Higher Risk for Chronic Rejection After Lung Transplantation. PMID:26517734
  19. Urinary CD59 and alpha-1 antitrypsin are significantly altered in hypertensive patients developing albuminuria. PMID:26772976
  20. levels of CSF CD59 in neuromyelitis optica and multiple sclerosis PMID:26686775
  21. Increased internalization of endothelial CD59 in intermittent hypoxia appeared to be cholesterol-dependent and was reversed by statins in a CD59-dependent manner. PMID:26738794
  22. Low urine CD59 expression is associated with clear cell renal cell carcinoma. PMID:26420021
  23. Decreased CD59 expression in threatened miscarriage at late gestational ages leads to additional activation of a maternal immune response and serves as a possible predictor for premature birth. PMID:26978230
  24. Data show that the palmitoylation mutation of linker for activation of T cells (LAT)attenuated the signal transduction induced by glycosylphosphatidylinositol-anchored CD59 antigen in T cells. PMID:26271970
  25. After blockage of CD59 function, the reactive Abs, regardless of their neutralizing activities, significantly enhanced specific ADCML of HIV-1 virions PMID:26136568
  26. Genetic risk at the CFH-to-F13B locus was associated with higher levels of complement activation at the human macular RPE-choroid interface, as was cigarette smoking. Levels of CRP were substantially elevated in risk donors with smoking history. PMID:26218915
  27. A primary homozygous Cys89Tyr CD59 deficiency in humans resulted in the amino acid substitution p.Cys89Tyr with ensuing failure of proper localization of the CD59 protein to the cell surface. (Review) PMID:25818314
  28. Increased CD59 protein expression is associated with the outcome of patients with diffuse large B-cell lymphoma treated with R-CHOP antineoplastic protocol. PMID:24924474
  29. Data suggest that microRNA-224 directly down-regulates CD59 antigen expression in diffuse large B-cell lymphoma by binding to CD59 3'-untranslated region. PMID:25146331
  30. Expression of membrane complement regulators, CD46, CD55 and CD59, in mesothelial cells of patients on peritoneal dialysis therapy. PMID:25725314
  31. The presence of CD55- and/or CD59-deficient erythrocytic populations in patients with rheumatic diseases reflects an immune-mediated bone-marrow derived phenomenon. PMID:24463881
  32. Provirus activation plus CD59 blockage triggers antibody-dependent complement-mediated lysis of latently HIV-1-infected cells. PMID:25149467
  33. Data indicate that down-regulation of CD59 expression could inhibit HeLa cells' proliferation and promote apoptosis, and the inhibitory effect of peptide seal was better than that of CD59 interference plasmid. PMID:24909278
  34. The expression levels of CD46, CD55, and CD59 were significantly higher in colon cancer tissues compared with the normal adjacent colon tissues. PMID:24978917
  35. this study observed robust relationships between a single measurement of blood levels of GCD59 and both acute (2-hour OGTT) and chronic (HbA1c) measures of glucose handling. PMID:24628556
  36. Hemolytic uremic syndrome evolved independently from CD55 and CD59 expression on peripheral blood cells in enteroaggregative E.coli O104:H4 infected patients. PMID:24086391
  37. Data suggest that CD59 gene might be a genetic locus for the therapy of atherosclerosis. PMID:24084445
  38. We found that CD46 and CD59 were decreased in retinal pigment epithelium cells in part, by their release in exosomes and apoptotic particles. PMID:24664706
  39. Use of AAV2/8-sCD59 warrants further exploration as a potential therapy for advanced stages of diabetic retinopathy PMID:24167638
  40. Sp1 may regulate the expression of CD59, whereas CREB-binding protein (CBP)/p300 bridge NF-kappaB and CREB, which functions as an enhancer-binding protein to induce the up-regulation of CD59 during in lipopolysaccharide (LPS)-triggered complement activation. PMID:24338025
  41. CD59 silencing in NSCLC cancer cells via retrovirus-mediated RNAi can enhance complement-mediated cell apoptosis, inhibiting the growth of NSCLC. CD59 may serve as a potential target for gene therapy in NSCLC PMID:23835643
  42. mutation of palmitoylation site of LAT-EGFP attenuated the signal transduction of CD59 in T cells PMID:24200054
  43. The primary CD59-ILY binding site is composed of a side-to-side contact between the beta hairpin extension of ILY D4 and the core beta sheet of CD59. PMID:23665225
  44. Data show that increased CD35, CD46, CD55 and CD59 on neutrophils and monocytes present potent markers of bacterial infection and viral infection. PMID:23376460
  45. Hematology and diabetes: from hemoglobin A1c to CD59 glycation. PMID:23757192
  46. a novel, sensitive, and specific ELISA for measuring GCD59 in blood. The assay distinguished individuals with diabetes from those without, and showed strong correlation between GCD59 and HbA1c. PMID:23670858
  47. CD59 was a type of membrane-bound protein, CD59 and Cbp played synergistic roles in cell activation and proliferation. PMID:23746236
  48. HCV incorporates selectively CD59, but not CD46 or CD55, in its envelope to gain resistance to CML in serum of infected individuals PMID:23049856
  49. A Cys89Tyr mutation is associated with improper cell-surface localization of CD59. This mutation is manifested clinically in infancy by chronic hemolysis & relapsing peripheral demyelinating disease. PMID:23149847
  50. findings demonstrated that decreased CD59 expression on T cells significantly enhanced activation and proliferation of CD4( ) T cells and CD8( ) T cells; data support that CD59 down-regulates antigen-specific activation of T lymphocytes in a ligand-dependent manner PMID:22480874

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Secreted. Note=Soluble form found in a number of tissues.
Database Links

HGNC: 1689

UNIGENE: Hs.278573

KEGG: hsa:966

STRING: 9606.ENSP00000340210

OMIM: 107271

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1