Recombinant Human C-X-C motif chemokine 9 (Cxcl9)

Code: CSB-EP006252HUc7
Size:
20ug
20ug100ug1mg
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human CXCL9 protein
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
CXCL9
Uniprot NO.
Research Area
Immunology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
23-125aa
Target Protein Sequence
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.
Gene References into Functions
  1. CXC chemokine ligand 9 promotes the progression of diffuse large B-cell lymphoma in a beta-catenin-dependent manner. PMID:30130730
  2. CXCL9 level was significantly higher in alopecia areata patients compared with controls and with vitiligo patients PMID:27863059
  3. CXCL9 may promote prostate cancer progression via inhibition of cytokines from T cells. PMID:29901197
  4. High CXCL9 expression is associated with invasion and metastasis in tongue squamous cell carcinoma. PMID:29286143
  5. MIG low in the tumor microenvironment can be used as potential indicators for the progression of non-small cell lung cancer PMID:28375674
  6. the results of the current study revealed increased serum levels of MIG as a novel independent marker of poor prognosis in newly diagnosed patients with MM. PMID:26999330
  7. High CXCL9 expression is associated with clear-cell renal cell carcinoma. PMID:26910919
  8. Circulating CXCL9 serum levels are high in chronic Q fever patients and is a promising biomarker for the diagnosis of chronic Q fever. PMID:28793883
  9. High urine CXCL9 level is associated with acute rejection in Histologically Stable Kidney transplant Recipients. PMID:26694099
  10. CXCL9 expression in lesional macrophages implicates the skin as the source of circulating cytokines. CXCL9 is a promising biomarker of disease activity in morphea. PMID:28450066
  11. significant correlation between serum levels and the severity of coronary artery disease, quantified by the Gensini score PMID:28100872
  12. High CXCL9 plasma levels favour response to pegIFN alpha 2a and ribavirin in hepatitis C virus infected patients regardless of DPP4 activity. PMID:26344576
  13. CXCL9 is a useful predictor of better clinical outcome in colorectal cancer patients. PMID:26898419
  14. The mRNA expression and serum levels of CXCL9 were both increased. PMID:26828996
  15. Data show that asymptomatic patients with unstable plaques exhibited higher levels of endothelial microparticles (EMPs), CXCL9 chemokine and stem cell growth factor; lymphocyte secreted C-type lectin (SCGF-beta) compared to those with stable plaques. PMID:26564003
  16. congruent with the concept that inflammation plays a key role in the pathogenesis of LV dysfunction, MIG, IP10 and I-TAC add diagnostic accuracy over and beyond NT-pro BNP. PMID:26506526
  17. Suggest that CD44 and CXCL9 may serve as predictive biomarkers to identify liver allograft recipients at risk for clinically significant acute graft rejection. PMID:25950774
  18. Knock-down of CD44 resulted in an upregulation of mRNA expression of the chemokines CXCL9 and CXCL12, as well as their receptors CXCR3 and CXCR4. PMID:24614402
  19. There were no significant differences in distribution of CXCL9 genotypes and alleles between rheumatoid arthritis patients and control group. PMID:25702175
  20. This work confirms that OPN, CCL5 and CXCL9 plasma levels are higher in psoriasis patients and provides evidence that their higher levels are not a consequence of obesity. PMID:25972108
  21. This inhibitory action of resveratrol was also observed for the cytokines-induced expression of chemokines CXCL9, CCL2 and CCL5. PMID:25890876
  22. This paper suggests a role for Epithelial to mesenchymal cell transition in the pathogenesis of idiopathic pulmonary fibrosis and provides a novel mechanism for the inhibitory effects of CXCL9 on TGF-beta1-induced Epithelial to mesenchymal cell transition. PMID:26268659
  23. The expression of TNF-alpha and CXCL9 in blood samples stimulated with a bacterial antigen distinguishes active tuberculosis patients from latent disease carriers and healthy controls. PMID:25528189
  24. CXCL9 inhibits the proliferation of epithelial cells via phosphorylation of p70S6K, resulting in the excretion of TGF-beta as downstream mediator. CXCL9/CXCR3 interaction can exacerbate antineoplastic agent-induced intestinal damage. PMID:25398650
  25. CXCL9 is involved in the invasion ability of hepatocellular carcinoma cells possibly through up-regulation of its potential effector PREX2. PMID:25151370
  26. both bactericidal and cell-recruiting activities of MIG/CXCL9 are corrupted by P. aeruginosa through release of elastase, and this may contribute to impaired airway host defense in CF. PMID:25115612
  27. Elevated IL-2R, IL-1RA, and CXCL9 are associated with shorter event-free survival in newly diagnosed follicular lymphoma, treated with chemoimmunotherapy. PMID:25422100
  28. CXCL9 expression was low in control skin, mild in perilesional skin from slowly progressive vitiligo and high in progressive vitiligo. Such expression was found in the epidermal as well as the dermal infiltrate. PMID:24438589
  29. study demonstrated that CXCL9 is associated with tumor burden and aggressiveness of NPC tumors and the serum level of this ligand may be useful as a prognostic indicator PMID:24278236
  30. Higher circulating levels of CXCL-9 and -11 have been shown in non-pregnant autoimmune thyroiditis patients with a history of recurrent abortion as compared to both control groups PMID:24351073
  31. In this study of human cryoglobulinemic glomerulonephritis we showed a striking expression of cytokine CXCL9, a classical macrophage activation marker, by the macrophages and possibly other cell types within the glomeruli. PMID:24084359
  32. High urinary CXCL9 is associated with kidney transplant injury. PMID:23968332
  33. CXCL9 associated with sustained virological response in chronic hepatitis B patients receiving peginterferon alfa-2a therapy. PMID:24124595
  34. Plasma concentrations of CXCL9 are elevated at the onset of chronic graft-versus-host disease diagnosis, but not in patients with chronic graft-versus-host disease for more than 3 months. PMID:24363401
  35. Collectively, our results show that a diverse milieu of chemokines is expressed in myocardium and valvular tissue lesions and emphasize the role of CXCL9/Mig in mediating T cell recruitment to the site of inflammation in the heart. PMID:23417848
  36. Our study demonstrated that CXCL9 is associated with tumor burden and aggressiveness of OSCC tumors and serum level of this ligand may be useful as a prognostic indicator PMID:23769451
  37. CXCL9 was increased in lung transplant lavage fluid during diffuse alveolar damage, acute rejection, and lymphocytic bronchiolitis. Elevated CXCL9 was associated with increased risk of chronic allograft dysfunction. PMID:24063316
  38. Our study demonstrates in mixed cryoglobulinemia and hepatitis C vs controls: (i)high serum CXCL9 and CXCL11, significantly associated with the presence of active vasculitis; (ii) a strong relationship between circulating CXCL9 and CXCL11 PMID:23527708
  39. The secretion of CXCL9 by activated T cells is also increasingly downregulated with increasing concentrations of bortezomib. PMID:23179902
  40. Report high serum levels of CXCL9/TNF-alpha/interferon-gamma in patients with mixed cryoglobulinaemia and chronic hepatitis C. PMID:22766105
  41. Intragraft CXCL9 mRNA has a functionally important role in T-cell activation in liver allograft and serves as biomarker for acute cellular rejection. PMID:22889476
  42. CXCL9 is localized predominantly in the cytoplasm of breast cancer cells and prostaglandin E2 inhibits cytokine induced CXCL9 secretion. PMID:22333315
  43. Malaria-infected primigravidae with placental CXCL9 levels in the lowest tertile gave birth to babies who weighed 610 g more than babies born to mothers with high CXCL9 levels. PMID:22689822
  44. Elevated plasma levels of MIG are associated with inflammatory bowel disease with JCV infection. PMID:22467521
  45. HSV-2 induces CXCL9 expression in human cervical epithelial cells by activation of p38-C/EBP-beta pathway PMID:22586042
  46. Autophagy may be a crucial intracellular mechanism of Mig induction in response to HBV infection. PMID:22580676
  47. Immunohistochemically, the lining synovium of Rheumatoid Aarthritis clearly expressed CXCL9 PMID:22401175
  48. Elevated plasma levels of interferon-gamma and Cys-X-Cys chemokine receptor 3-binding chemokine CXCL9 are present in patients with thoracic aortic aneurysms. PMID:21962843
  49. We found that urine CXCL9 and CXCL10 were markedly elevated in adults and children experiencing either AR or BKI (p = 0.0002), but not in stable allograft recipients PMID:21812928
  50. We first show that circulating CXCL9 and CXCL11 are increased in patients with thyroiditis and hypothyroidism and are related to each other. PMID:21470996

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine alpha (chemokine CxC) family
Database Links

HGNC: 7098

UNIGENE: Hs.77367

KEGG: hsa:4283

STRING: 9606.ENSP00000354901

OMIM: 601704

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products