Abbreviation
Recombinant Human CCL17 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Anti-CCL17 recombinant antibody (CSB-RA856406MA1HU) at 2 μg/mL can bind Human CCL17 protein. The EC50 is 2.403-2.741 ng/mL.
Alternative Names
C-C motif chemokine 17; CC chemokine TARC; Small-inducible cytokine A17; Thymus and activation-regulated chemokine; CCL17; SCYA17, TARC
Species
Homo sapiens (Human)
Expression Region
24-94aa
Target Protein Sequence
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal mFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Anti-CCL17 recombinant antibody (CSB-RA856406MA1HU) at 2 μg/ml can bind Human CCL17 protein. The EC50 is 2.403-2.741 ng/mL.
Description
CCL17 orchestrates Th2 cell recruitment and is a key mediator in allergic inflammation and atopic diseases, making it a critical target for dissecting T cell–driven immune responses. This mammalian-expressed protein spanning residues 24–94 demonstrates robust receptor engagement with an EC50 of 2.403–2.741 ng/mL in functional ELISA, providing quantitative evidence of its binding potency suitable for chemotaxis assays, T cell migration studies, and signaling pathway investigations targeting CCR4-mediated activation. Endotoxin levels below 1.0 EU/μg meet the stringent criteria required for primary immune cell assays, where LPS contamination would confound interpretation of CCL17-specific effects on T cell proliferation, differentiation, or cytokine secretion. The C-terminal mFc tag facilitates immobilization in binding assays and antibody validation workflows, while purity exceeding 95% supports its use as a coating antigen in ELISA development and as a reference standard in cytokine detection platforms.
