Abbreviation
Recombinant Human BTLA protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized BTLA at 5 μg/ml can bind biotinylated human TNFRSF14 (CSB-MP842173HU-A), the EC50 is 137.8-233.4 ng/ml.
Alternative Names
(B- and T-lymphocyte-associated protein)(CD272)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
31-150aa
Target Protein Sequence
KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized BTLA at 5 μg/ml can bind biotinylated human TNFRSF14 (CSB-MP842173HU-A), the EC50 is 137.8-233.4 ng/ml.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human BTLA at 2μg/ml can bind Anti-BTLA recombinant antibody(CSB-RA773799MAIHU), the EC50 is 1.763-3.542 ng/mL.
Description
BTLA (CD272) functions as a coinhibitory receptor in the immune checkpoint network, engaging HVEM (TNFRSF14) to dampen T- and B-cell activation—making it a compelling target in immuno-oncology drug discovery. This recombinant human BTLA encompasses the extracellular ligand-binding domain (aa 31–150) with a C-terminal hFc1-Myc tag, and mammalian cell expression preserves the native folding and post-translational modifications critical for faithful receptor-ligand interaction. Functional ELISA confirms robust binding to biotinylated human TNFRSF14 with an EC50 of 137.8–233.4 ng/ml, providing validated support for ligand-binding assays, competitive inhibition studies, blocking antibody screening, and therapeutic antibody epitope mapping. Purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg satisfy the quality thresholds commonly required for SPR- or BLI-based affinity characterization, small-molecule inhibitor screening, and use as a positive control in checkpoint receptor binding assays.
