Recombinant Human Aquaporin-1 (AQP1), partial

In Stock
Code: CSB-EP001957HUe0
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal GST-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
AQP1
Uniprot NO.
Alternative Names
Aquaporin-CHIPUrine water channelWater channel protein for red blood cells and kidney proximal tubule
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
220-269aa
Target Protein Sequence
GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.6kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Recombinant Human Aquaporin-1 (AQP1) is produced in E.coli, covering amino acid region 220-269 with an N-terminal GST tag that helps with solubility and purification. The protein comes with purity levels exceeding 90%, confirmed through SDS-PAGE analysis, which should provide reliable results for experimental work. This product is meant for research use only and isn't intended for therapeutic or diagnostic purposes.

Aquaporin-1 (AQP1) is a water channel protein that moves water across cell membranes, playing an important role in various physiological processes. The protein is involved in regulating water homeostasis and appears to be a key component in several tissues, including the kidney, lung, and vascular system. AQP1's function in water transport makes it a valuable target for research on fluid balance and cellular hydration.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

AQP1 is a transmembrane channel protein whose function depends on its complete six-transmembrane helix structure forming a proper pore. This partial fragment (50 amino acids) represents only a small intracellular portion of the protein and lacks the transmembrane domains necessary for native folding. The GST tag may further interfere with proper structural formation. While the protein may be soluble, it is highly unlikely to adopt any biologically relevant conformation or possess water channel activity. The probability of correct folding is extremely low. Using a misfolded, isolated domain of a membrane protein for interaction screening is highly likely to generate misleading results.

1. Antibody Development and Validation
This AQP1 fragment serves as a suitable immunogen for generating antibodies specific to this C-terminal region. The high purity minimizes antibodies against contaminants. These antibodies will be particularly useful for detecting linear epitopes in techniques like Western blotting. However, they may not recognize conformational epitopes present on the full-length, membrane-embedded protein.

2. Biochemical Characterization of Protein Stability

This application is the essential first step to characterize the biophysical properties of this fragment. Techniques like circular dichroism can assess if it has any defined secondary structure (e.g., alpha-helical content, as this region is intracellular and may be structured) and determine its stability under various conditions. This data is crucial for understanding the behavior of this isolated domain.

Final Recommendation & Action Plan

This recombinant AQP1 protein is a fragment of a complex membrane protein and is unlikely to be correctly folded, limiting its applications to non-structural uses. The immediate priority is Application 2 (Biochemical Characterization) to determine if the fragment has any inherent structure and to establish its stability profile. It is reliable for Application 1 (Antibody Development). Interaction studies and binding assays must be avoided as they require a native fold. For functional studies of AQP1 interactions, the recommended path is to use the full-length protein reconstituted in liposomes or to study interactions in a cellular context where the protein is properly localized and folded. This AQP1 protein should be considered primarily as an antigen source, not a functional protein domain.

Customer Reviews and Q&A

 Customer Reviews
 Q&A
Q:

What I would like to know is whether this product CSB-RP160844h(A4) has been purified and dialysed to remove residue of reduced glutathione?

A:
Very nice to receive your inquiry. CSB-RP160844h(A4) is purified by GST agarose gel affinity chromatography.
The residue of reduced glutathione will be removed after purification.

Target Background

Function(From Uniprot)
Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
Gene References into Functions
  1. Case-control analyses reveal significant overrepresentation of rare variants in ATP13A3, AQP1 and SOX17, and provide independent validation of a critical role for GDF2 in heritable pulmonary arterial hypertension. PMID:29650961
  2. Study demonstrated that a region upstream of the AQP1 gene (- 2300 to - 2200 bp) contains an enhancer required for pH-mediated regulation of AQP1 gene expression. PMID:29554889
  3. H19 acted as AQP1 ceRNA in regulating miR-874. PMID:30021355
  4. Data show that miR-320 negatively regulates aquaporin 1 (AQP1) expression by targeting its 3' untranslated regions (3'-UTR). PMID:29538612
  5. The present study represents further confirmation of the hypothesized prognostic role of AQP1, which seems a reliable prognostic indicator. PMID:29495596
  6. AQP1 may serve a role in glioblastoma multiforme migration, invasion and vasculogenic mimicry formation PMID:29257313
  7. Adenovirus-mediated human AQP1 expression in hepatocytes improves lipopolysaccharide-induced cholestasis in rats. PMID:29087027
  8. AQP1 may interact with VEGFA and play a role in vasculogenic mimicry, especially under hypoxic conditions, but the heterogeneity of malignant mesothelioma cells may result in different dominant pathways between patients. PMID:29104239
  9. AQP1, 3 and 5 expression through the stages of human salivary gland morphogenesis, was examined. PMID:28766180
  10. AQP1 was elevated in the majority of ovarian cancer tissues. Notably, the present study, to the best of our knowledge, suggests for the first time that AQP1 exhibits a key role in the viability, apoptosis, migration and invasion of ovarian cancer cells. PMID:28849036
  11. AQP1 is expressed in atherosclerotic lesion neovasculature in human and mouse arteries and AQP1 deficiency augments lesion development in angiotensin II-promoted atherosclerosis in mice. PMID:28129470
  12. Strong aquaporin 1 protein expression was an independent adverse prognosticator in hilar cholangiocarcinoma. PMID:27143047
  13. Findings suggest that a defined population of AQP4- and AQP1-expressing reactive astrocytes may modify alpha-syn deposition in the neocortex of patients with Parkinson's Disease. PMID:26919570
  14. The BRAF V600 mutations were significantly associated with AQP1 expression (P=0.014). Long-term follow-up indicated a reduced progression-free survival (P=0.036) and overall survival (P=0.017) for the AQP1-positive cutaneous melanoma patients. PMID:26848795
  15. The expression of AQP1 and 3 is a manifestation of physiological adaptation of functionally mature chondrocytes able to respond to the change of their internal environment influenced by extracellular matrix. PMID:28708257
  16. function of AQP1 in tonicity response could be coupled or correlated to its function in band 3-mediated CO2/HCO3(-) exchange PMID:28596233
  17. Data show that the expression of aquaporin (AQP) 1, AQP3, AQP5, epithelial Na+ channel (ENaC) and sodium potassium ATPase (Na-K-ATPase) are altered in patients with acute respiratory failure (ARF) due to diffuse alveolar damage (DAD), and the cause of DAD does not seem to influence the level of impairment of these channels. PMID:27835672
  18. The native AQP1 gene, normally latent in human salivary gland cells, can be activated by both promoter-independent artificial transcription and epigenetic editing of the promoter. PMID:28072927
  19. data suggest an important functional role of AQP1 in the pathobiology of hypoxia-induced pulmonary hypertension PMID:28409279
  20. We demonstrated that AQP1-like immunoreactivity and expression are significantly increased in plaques of Peyronie's disease patients Vs controls, implying that AQP1 overexpression might be the consequence of a localized maladaptive response of the connective tissue to repeated mechanical trauma PMID:26972451
  21. AQP-1 overexpression is associated with prostate cancer progression. PMID:27817002
  22. Study provides evidence that Mef2c cooperated with Sp1 to activate human AQP1 transcription by binding to its proximal promoter in human umbilical cord vein endothelial cells indicating that AQP1 is a direct target of Mef2c in regulating angiogenesis and vasculogenesis of endothelial cells. PMID:26923194
  23. AQP1 was overexpressed in cystic cholangiocytes of patients with polycystic liver disease. A tendency of increased AQP1 protein expression in correlation with the cyst size was also found. PMID:26838488
  24. Aquaporin1 overexpression restored anti-cell proliferation and metastatic effect of si-Gli1. PMID:27157540
  25. AQP1 expression was significantly lower in hereditary spherocytosis patients and silent carriers than in the simultaneously processed normal control, while no AQP1 decrease was detected in the autoimmune hemolytic anemia sample. The decreased AQP1 expression could contribute to explain variable degrees of anemia in hereditary spherocytosis. PMID:27465156
  26. High cytoplasmic expression of AQP1 is associated with breast cancer progression. PMID:26812884
  27. Suggest that sputum AQP1 and AQP5 could be used as diagnostic markers in mild-to-moderate adult-onset asthma. PMID:26823734
  28. the downregulation of AQP1 impedes extracellular to intracellular fluid transportation. PMID:26549133
  29. Based on a comparative mutagenic analysis of AQP1, AQP 3, and AQP 4, the results suggest that loop D interactions may provide a general structural framework for tetrameric assembly within the AQP family. PMID:26786101
  30. The role of AQP1 in malignant pleural mesothelioma. PMID:26773069
  31. Urinary AQP1 is significantly lower in patients with clear cell renal carcinoma than in controls. Urinary AQP1 increases after nephrectomy in clear cell renal carcinoma patients. PMID:27295912
  32. AQP1 knockdown can effectively inhibit cell proliferation, adhesion, invasion and tumorigenesis by targeting TGF-beta signaling pathway and focal adhesion genes. PMID:26176849
  33. These data provide support for a continuous role of KLF2 in stabilizing the vessel wall via co-temporal expression of eNOS and AQP1 both preceding and during the pathogenesis of atherosclerosis. PMID:26717516
  34. The study demonstrated the abnormal expression pattern of AQP1, AQP2, AQP3, and AQP4 in the kidney tissues of patients with nephrotic syndrome, providing a basis for an improved understanding of the role of aquaporins in the pathogenesis of this disease. PMID:26261083
  35. The results suggest that AQP1 may facilitate lung cancer cell proliferation and migration in an MMP-2 and-9-dependent manner PMID:26151179
  36. PBEF regulates the expression of inflammatory factors and AQP1 through the MAPK pathways. PMID:26178576
  37. the benign subependymomas aquaporins 1 and 4 are dramatically redistributed and upregulated. PMID:26115524
  38. AQP1 was found to be a marker of a subgroup of aggressive basaloid-like squamous cell carcinomas PMID:26074259
  39. High AQP1 expression is associated with recurrence in bladder uroepithelial cell carcinoma . PMID:25987071
  40. The AQP1 rs1049305 single nucleotide polymorphism is associated with running performance, but not relative body weight change, during South African Ironman Triathlons. PMID:25495276
  41. The data suggest that the increased expression of AQP1 and AQP3 in pterygial tissues may be involved in the pathogenesis of pterygia PMID:23974882
  42. CAII increases water conductance through AQP1 by a physical interaction between the two proteins. PMID:25609088
  43. Aquaporin 1 and 3 were upregulated in cervical cancer compared to mild cervicitis and cervical intraepithelial neoplasia 2-3 (P<0.05). PMID:24918928
  44. Through molecular genotyping we also identified polymorphisms in RhCE, Kell, Duffy, Colton, Lutheran and Scianna loci in donors and patients. PMID:25582271
  45. Study found a significant correlation between AQP1, AQP3, and AQP5 overexpression and lymph node metastasis in patients with surgically resected colon cancer. PMID:25721378
  46. the reduction of aquaporins 1 and 3 may be a factor resulting in lumbar intervertebral disc degeneration. PMID:25299207
  47. AQP1 over-expression effectively inhibited cell proliferation and induced cell growth arrest in G1 phase of K562 cells. PMID:25252847
  48. Aquaporin-1 is induced in leukocytes of patients with sepsis and exhibits higher expression in septic shock. PMID:24028651
  49. Report is the first to establish astrocytic water channel loss in a subset of human central pontine myelinolysis (CPM) cases and suggests AQP1 and AQP4 may be involved in the pathogenesis of CPM PMID:24252214
  50. Aquaporin-1 is associated with arterial capillary proliferation and hepatic sinusoidal transformation contributing to portal hypertension in primary biliary cirrhosis. PMID:23949237

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Tissue Specificity
Detected in erythrocytes (at protein level). Expressed in a number of tissues including erythrocytes, renal tubules, retinal pigment epithelium, heart, lung, skeletal muscle, kidney and pancreas. Weakly expressed in brain, placenta and liver.
Database Links

HGNC: 633

UNIGENE: Hs.76152

KEGG: hsa:358

STRING: 9606.ENSP00000311165

OMIM: 107776

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products