Recombinant Human Apoptosis regulator BAX (BAX)

In Stock
Code: CSB-CF002573HU(A4)e0
Size:
20ug
20ug100ug
US$1620
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal GST-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human BAX protein
Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
BAX
Uniprot NO.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-192aa
Target Protein Sequence
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.7
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.
Gene References into Functions
  1. Pro-apoptotic protein Bax is main effector of mitochondrial permeabilization during apoptosis. Data suggest Bax N-terminal acetylation by mouse NatB (or yeast Naa20p) is involved in mitochondrial targeting of Bax. These studies used recombinant human Bax expressed in yeast cells plus cultured embryonic cells from knockout, transgenic, and chimeric mice. (NatB and Naa20p = N-terminal acetyltransferases) PMID:29233735
  2. This result suggests that p53 has an important role in hemangioma endothelial cell (HemEC) apoptosis. The results of the present study additionally suggest that the propranololinduced HemEC apoptosis pathway is a mitochondrial apoptosis pathway and is regulated by p53BAX signaling. PMID:29767244
  3. The results of the present study revealed that the combination of P. gingivalis and H1N1 infection in lung epithelial cells may promote the production of inflammatory cytokines and increase NO production, leading to increased levels of apoptosis in lung epithelial cells via the Bcl2/Bax/caspase3 signaling pathway. PMID:29750299
  4. Bax activator BTC-8 inhibited glioblastoma (GBM) cell proliferation, arrested the cell cycle, and induced apoptosis through the induction of mitochondrial membrane permeabilization. Most importantly, BTC-8 blocked proliferation and self-renewal of glioma stem cells (GSC) and induced their apoptosis. BTC-8 was demonstrated to sensitize both GBM cells and GSCs to the alkylating agent Temozolomide. PMID:28368610
  5. BAX nuclear localization was associated in vivo with the remodelling of lung parenchyma during development, tumorigenesis as well as fibrosis compared to control adult human lungs PMID:28933587
  6. There is no significant association between BAX gene polymorphism and cancer susceptibility, but it probably contributes to increased adverse prognosis to cancer. PMID:30024563
  7. These results suggest that chlorogenic acid (CGA)suppresses hLECs apoptosis and prevents lens opacity induced by H2O2 via Bax/Bcl2 signaling pathway. CGA may provide effective defenses against oxidative stress and, thus, has potential as treatment for a variety of diseases in clinical practice. PMID:29207051
  8. Ru(II)/diphenylphosphine/pyridine-6-thiolate complexes induce S-180 cell apoptosis through intrinsic mitochondrial pathway involving inhibition of Bcl-2 and p53/Bax activation. PMID:28795366
  9. helix alpha9 assists Bax activation via the dimer heterogeneity and interactions with specific MOM lipids, which eventually facilitate proteolipidic pore formation in apoptosis regulation PMID:27381287
  10. VDAC2 ensures mitochondria-specific membrane association of Bax and in the absence of VDAC2 Bax localizes towards other cell compartments. Bax retrotranslocation is also regulated by nucleotides and calcium ions, suggesting a potential role of the transport of these ions through VDAC2 in Bax retrotranslocation. PMID:27620692
  11. The results of the genes expression analysis revealed that indocyanine green-photodynamic therapy at concentrations 1000mug/mL, induced the significant expression of BAX in HGF cells PMID:28438509
  12. Our observations point to misfolded Bax states, shedding light on the molecular mechanism of Bax mutation-elicited cancer. Most importantly, the structure of the Bax pore facilitates future study of releases cytochrome C in atomic detail PMID:27630059
  13. Data suggest that regulation of pancreatic beta-cell function and survival/apoptosis involves alternative splicing modulated by key splicing regulator SRP55; SRP55-regulated alternative splicing includes modulation of function of pro-apoptotic proteins (BIM, BAX), JNK signaling, and endoplasmic reticulum stress. (SRP55 = pre-mRNA-splicing factor SRP55; BIM = BCL-2 interacting protein BIM) PMID:29246973
  14. High expression of BAX is associated with colorectal cancer. PMID:28586030
  15. High mitochondrial Bax apoptosis regulator protein (BAX) levels correlate with improved acute myeloid leukemia (AML) patient survival. PMID:28420723
  16. parkin-dependent targeting of misregulated BAX on the mitochondria provides substantial protection against BAX apoptotic activity. PMID:28760928
  17. our data present preliminary evidence that inherited abnormalities in the intrinsic apoptosis pathway, related to BAX G(-248)A and BCL2 C(-717)A SNPs, are associated with treatment response and act as independent prognostic factors in DLBCL. PMID:27098707
  18. SFRP5 confers protection against oxidative stress-induced apoptosis through inhibition of beta-catenin activation and downregulation of Bax. PMID:28834606
  19. The ratio of Bax/Bcl-2 was significantly enhanced by the Ginsenoside Rg3 to Paclitaxel. PMID:28231544
  20. this study show that PATZ1 expression correlates positively with BAX and negatively with BCL6 and survival in human diffuse large B cell lymphomas PMID:27494852
  21. YY1 promotes apoptosis via upregulating Bax transcription and subsequent activation of Bax by translocation from the cytosol to the mitochondrial membrane. PMID:27074573
  22. Immunohistochemical analysis showed that STAT3, GRP78 and BAX protein levels in the combination group were significantly higher than those in STAT3 group and CDDP group (P<0.05). Exogenous STAT3 and CDDP may synergistically inhibit the xenograft tumour growth through up-regulation of BAX protein via GRP78. PMID:27129294
  23. This is the first study evaluating the potential relationship between BCL2 and BAX gene polymorphisms and RRD in a Greek population, showing a significant association between BAX rs4645878 polymorphism and RRD susceptibility. This finding suggests that an apoptotic mechanism is implicated in the pathogenesis of RRD PMID:28877516
  24. Heavy ion irradiation could induce p53(-/-) hepatoma cells to undergo apoptosis via E2F1/Bax/Casp3 signaling pathway. PMID:28500630
  25. Bax effects were dependent on its oligomeric state. Monomeric Bax did not affect the membrane, oligomeric Bax lowered the breakthrough force of the membrane, which in the context of pore formation, implies a lowering of the line tension at the edge of the pore. PMID:27755971
  26. The C-terminal helical conformation of Bax, not its primary sequence, appears to be critical for CASP8 recruitment and activation culminating in cell death. PMID:28807790
  27. An autoinhibited dimeric form of BAX regulates the cytosolic BAX activation pathway. PMID:27425408
  28. Although TP53 and BAX immunoreactivity levels were associated with some clinicopathological parameters of the patients, the expression of EP300, TP53 and BAX did not reveal any prognostic significance in ccRCC PMID:28551630
  29. Cells expressing mitoCERT import ceramides into mitochondria and undergo Bax-dependent apoptosis. PMID:27888218
  30. Results support the hypothesis that the mitochondrion-specific lipid cardiolipin functions as a first contact site for Bax during its translocation to the mitochondrial outer membrane in the onset of apoptosis. In addition, dye leakage assays revealed that different oxidized phospholipids species in the mitochondrial outer membrane-mimicking vesicles can have opposing effects on Bax pore formation. PMID:28538152
  31. The substitution of proline 168 for alanine favors Bax oligomerization. PMID:28322731
  32. Data show that the increased acetylation of Ku autoantigen 70kDa (Ku70) in sirtuin 6 protein (SIRT6)-depleted cells disrupt its interaction with Bax apoptosis regulator protein (Bax), which finally resulted in Bax mitochondrial translocalization. PMID:28238784
  33. Rhaponticum carthamoides extracts from transformed and normal roots increased the ratio of Bax/Bcl-2 proteins and increased TP53 levels to reduce glioma cell proliferation. PMID:27696406
  34. these results indicate that EVA71 infection directly impacts the mitochondrial apoptotic pathway by modulating the recruitment and activation of Bax. PMID:28073399
  35. the present study demonstrated that DAPK contributed to the Hcyinduced endothelial apoptosis via modulation of Bcl2/Bax expression levels and activation of caspase 3 PMID:27633052
  36. The present study evaluates the prognostic role of the p53, Bax, Bcl-2 and cyclin E immunoexpression in colon cancer. PMID:27151692
  37. The high expression of the BAX gene seems to be a negative regulator of autophagy in colorectal cancer cells. The relative downregulation of autophagy-related genes was observed in colorectal cancer samples. PMID:28035578
  38. High expression of BAX is associated with hepatocellular carcinoma. PMID:27699664
  39. Low BAX/BCL2 mRNA is associated with laryngeal squamous cell carcinoma. PMID:27129795
  40. It was concluded that ginsenoside Rh2-O induced apoptosis of HepG2 cells through activation of the lysosomal-mitochondrial apoptotic pathway involving the translocation of Bax to the lysosome. PMID:27120618
  41. Findings reveal a novel mechanism by which p53 utilizes TFIIS.h to selectively promote the transcriptional elongation of the bax gene, upsurging cell death in response to severe DNA damage. PMID:27005522
  42. elevated MMP-2 expression and disturbance balance of Bcl-2/BAX expressions may be associated with the development and maintenance of atrial fibrillation. PMID:27141955
  43. TG2 can inhibit tumor cell apoptosis through down-regulation of Bax and prevention of release Cyt C from mitochondria into cytoplasm PMID:25561282
  44. Bcl-2 and Bax expression was significantly associated with histologic grade and clinical stage, which are classic factors of poor prognosis. We suggest the use of these proteins as potential prognostic markers in STS of extremities PMID:25906122
  45. The aim of this study was to determine the expression of apoptotic factors Bax, Bcl-2, and Caspase-3 in lens epithelial cells (LECs) from cataracts secondary to pars plana vitrectomy with silicone oil (SO) tamponade. PMID:26956740
  46. The expression of PHF20 was associated with Bax expression. PMID:26722404
  47. Deletion of chromosomal region 19q13.1-13.4 is common in hereditary non-polyposis colorectal cancer (CRC). This deletion could be the cause of the reduction in the expression of the BAX gene observed in CRC. PMID:26228962
  48. miR-449 regulates the SIRT1/p53/BAX pathway, which may be its possible mechanism in modulating cell apoptosis of cisplatin-induced Acute kidney injury. PMID:26968221
  49. Polymorphism of BAX and TP53 genes may be potential genetic modifiers for developing ovarian cancer. PMID:26209050
  50. BimEL-Bax pro-apoptotic cascade is activated by cAMP signalling of Bordetella adenylate cyclase toxin through SHP-1 phosphatase in phagocytes. PMID:26334669

Show More

Hide All

Subcellular Location
[Isoform Alpha]: Mitochondrion outer membrane; Single-pass membrane protein. Cytoplasm.; [Isoform Beta]: Cytoplasm.; [Isoform Gamma]: Cytoplasm.; [Isoform Delta]: Cytoplasm.
Protein Families
Bcl-2 family
Tissue Specificity
Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lu
Database Links

HGNC: 959

UNIGENE: Hs.624291

KEGG: hsa:581

STRING: 9606.ENSP00000293288

OMIM: 600040

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products