APO C1; Apo CI; Apo-CIB; Apo-CIB'; APOC 1; ApoC I; ApoC-IB; ApoC-IB'; APOC1; APOC1_HUMAN; APOC1B; Apolipoprotein C I; Apolipoprotein C I variant I; Apolipoprotein C-I; Apolipoprotein C1; Apolipoprotein CI; ApolipoproteinC I; ApolipoproteinCI; Truncated apolipoprotein C-I
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
27-83aa
Target Protein Sequence
TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
6.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.
Gene References into Functions
PPARgamma knockdown resulted in increased levels of TOMM40, APOE and APOC1 -mRNAs, showing the strongest impact on APOE transcript levels.PMID:28065845
Collectively, these findings suggest that apoC1 and apoE have redundant functions in the hepatitis C virus (HCV) infection and morphogenesis.PMID:30130702
the relationship between two variants of apoC1 and the risk of polycystic ovary syndrome, evaluated the genotypic effects on clinical, hormonal and metabolic indexes and plasma platelet-activating factor acetylhydrolase (PAF-AH) activity, was investigated.PMID:29636060
Performance metrics were used to select SNPs in stage 1, which were then genotyped to another dataset (stage 2). Four SNPs (CPXM2 rs2362967, APOC1 rs4420638, ZNF521 rs7230380, and rs12965520) were identified for LOAD by both traditional P-values (without correcting for multiple tests) and performance metrics.PMID:27805002
ApoC-I polymorphism might be one of the genetic factors of longevity in Bama; the ApoC-I rs4420638 and rs584007 SNPs are associated with serum triglycerides and high-density lipoprotein-cholesterol levels in the longevous populationPMID:28486432
Among white women, three single nucleotide polymorphisms (SNPs) (rs2075650 [TOMM40], rs4420638 [APOC1], and rs429358 [APOE]) were significantly associated with survival to 90 years after correction for multiple testing (p < .001); rs4420638 and rs429358 were also significantly associated with healthy aging (p = .02). In African American women, no SNP was associated with longevity. In Hispanic women, 7 SNPs in linkage disePMID:27707806
APOC1 expression induces glomerulosclerosis, potentially by increasing the cytokine response in macrophages.PMID:27976371
apoC-I inhibited in situ LPL activity in adipocytes in both a concentration- and time-dependent manner. There was no change in postprandial WAT apoC-I secretion. WAT apoC-I secretion may inhibit WAT LPL activity and promote delayed chylomicron clearance in overweight and obese subjectsPMID:27040450
People with allelic variation in four genes related to cardiovascular diseases and metabolism were more likely to die: apolipoprotein (APO)C1 GG and AG carriers, APOE varepsilon4 carriers, insulin-degrading enzyme (IDE) TC carriers, and phosphatidylinositol 3-kinase (PI3KCB) GG carriers.PMID:27806189
Common single-nucleotide polymorphism in the APOC1/APOE region, previously found to be associated with protective levels of cholesterol and lower cardiovascular risk, may be associated with ideal health.PMID:27179730
These findings indicated that variants in TOMM40/APOE/APOC1 region might be associated with human longevity. Further studies are needed to identify the causal genetic variants influencing human longevity.PMID:26657933
These results suggest that ApoC-I peptides may be a potential diagnostic biomarker and therapeutic approach for breast cancer.PMID:27052600
APOC1 SNP is associated with the A beta-42 levels in CSF.PMID:26576771
This sbioinformatics analysis explored the shared genetic etiology underlying Type 2 Diabetes and Alzheimer's Disease on SNP level, gene level, and pathway level. Six SNPs on APOC1 gene.PMID:26639962
The endogenous retroviral promoters (LTRs) of the human endothelin B receptor (EDNRB) and apolipoprotein C1 (APOC1) genes have high sequence identity but differ in activity and tissue specificity.PMID:12805445
The ability of apoC1 to inhibit CETP activity is impaired in patients with diabetes. Glycation of apoC1 leads to a change in its electrostatic properties that might account, at least in part, for a loss of constitutive CETP inhibition and an increase in plasma CETP activity in patients with diabetes.PMID:24574346
APOE e4 allele status is associated with dementia and severity of Alzheimer's disease pathologic features in Parkinson disease.PMID:24582705
Data indicate that apolipoprotein C-I (APOC1) rs11568822 polymorphism was associated with increased Alzheimer's disease (AD) risk in Caucasians, Asians and Caribbean Hispanics, but not in African Americans.PMID:24498013
results suggest that peptide-lipid interactions drive alpha-helix binding to and retention on lipoproteinsPMID:23670531
apoC-I and apoC-III inhibit lipolysis by displacing LPL from lipid emulsion particles. We also propose a role for these apolipoproteins in the irreversible inactivation of LPL by factors such as angptl4.PMID:24121499
Following regression analysis adjusted by collection center, gender, duration of diabetes, and average HbA1c, two SNPs were significantly associated with DN. rs4420638 in the APOC1 region and rs1532624 in CETP.PMID:23555584
Linkage disequilibrium between APOC1 and TOMM40 is found in patients with primary progressive aphasia but not in controls or patients with frontotemporal dementia.PMID:22710912
High concentrations of ApoCI are associated with increased triglycerides and decreased visceral fat mass in men with metabolic syndrome X.PMID:18835943
Increased white adipose tissue apoC-I secretion in obese women is associated with delayed postprandial dietary fat clearance mediated by increased triglyceride rich apoC-I.PMID:22995522
The plasma level of apoC-I was significantly increased in obese individuals compared with healthy individuals.PMID:22404376
apoC1 as a CETP inhibitor no longer operates on cholesterol redistribution in high-risk patients with dyslipidemiaPMID:22474067
The observed increase in apoC-I interface affinity due to higher degrees of apoC-I-palmitoyloleoylphosphatidylcholine/triolein/water interactions may explain how apoC-I can displace larger apolipoproteins, such as apoE, from lipoproteins.PMID:22264166
our approach, which is applicable to any set of interval scale traits that is heritable and exhibits evidence of phenotypic clustering, identified three new loci in or near APOC1, BRAP, and PLCG1, which were associated with multiple phenotype domains.PMID:22022282
Results describe the association of ACE and APOC1 gene polymorphisms with susceptibility to Alzheimer's disease and dementia in general, both alone and combined with the APOE gene.PMID:21533863
variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traitsPMID:21943158
Serum levels of apoC-I and apoC-III combined with other clinical parameters can serve as a basis for the formulation of a diagnostic score for stomach cancer patientsPMID:21267442
New isoforms of apoC-I, were detected in the cohort of individuals with coronary artery disease using mass spectrometry while the expected apoC-I isoforms were absent.PMID:21187063
This study examines the association between APOE/C1/C4/C2 gene cluster variation using tagging single nucleotide polymorphisms and plasma lipid concentration along with risk of coronary heart disease in a prospective cohort.PMID:20498921
data show that apoCI genotype is associated with serum levels of triglycerides and CRP, confirming the role of apoCI in lipid metabolism and suggesting that it also influences inflammationPMID:20580041
From genetic association studies in Canadian Oji-Cree subjects, APOC1 T45S polymorphism may be linked to obesity, adipocyte regulation, body fat, waist circumference, hyperglycemia, and plasma leptin and apolipoprotein C-I levels.PMID:19812053
Apolipoprotein C-I reduces cholesteryl esters selective uptake from LDL and HDL by binding to HepG2 cells and lipoproteinsPMID:19761869
ApoC-I may have an important role in glucose and lipid metabolism and may be useful for early demonstration of metabolic abnormality in women with polycystic ovary syndrome.PMID:19368908
ApoE e4 and APOC1 A alleles have a better association with Alzheimer disease than ApoE e4 alone.PMID:20145290
Results identified haptoglobin alpha-1, apolipoprotein C-I and apolipoprotein C-III as candidate biomarkers in PTC.PMID:19785722
Cholesteryl ester transfer protein is the sole major determinant of cholesteryl ester transfer in normolipidemic rabbit plasma as a result of the inability of rabbit apoCI to change HDL electronegativity.PMID:19417222
APOC1 might be an additional susceptibility gene for late onset Alzheimer disease.PMID:11825674
regulated expression of gene cluster in macrophagesPMID:12032151
Thermal unfolding of discoidal complexes of apolipoprotein (apo) C-1 with dimyristoyl phosphatidylcholine (DMPC) reveals a novel mechanism of lipoprotein stabilization that is based on kinetics rather than thermodynamics.PMID:12044170
Effects of mutations in apolipoprotein C-1 on the reconstitution and kinetic stability of discoidal lipoproteins.PMID:12705839
The effect of APOC1 genes on brain MRI measures were studied in subjects with age-associated memory impairment. The effects of APOC1 on hippocampal volumes appeared to be more robust than those of the APOE polymorphism.PMID:12736801
overexpression of APOC1 prevents rosiglitazone-induced peripheral fatty acid uptake leading to severe hepatic steatosisPMID:14523051
overexpression of apoCI does not represent a suitable method for decreasing total CE transfer activity in CETP/apoCI transgenic mice, owing to an hyperlipidaemia-mediated effect on CETP gene expressionPMID:15339254
apoC-I is a potent inhibitor of LPL-mediated triglyceride lipolysisPMID:15576844
role of apolipoprotein C1 in the infection process of hepatitis C virusPMID:15767578
Results suggested that both apoE and apoCI on chromosome 19 were the susceptibility loci for coronary artery disease, their linkage disequilibrium should be responsible for the development of coronary artery disease .PMID:15793777
Show
More
Hide
All
Subcellular Location
Secreted.
Protein Families
Apolipoprotein C1 family
Tissue Specificity
Synthesized mainly in liver and to a minor degree in intestine. Also found in the lung and spleen.