Recombinant Human Apolipoprotein C-I (APOC1)

Code: CSB-EP001930HUb0
Size:
20μg
20μg100μg1mg(1mg*1 or 500ug*2)
US$256
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
APOC1
Uniprot NO.
Research Area
Cardiovascular
Alternative Names
APO C1; Apo CI; Apo-CIB; Apo-CIB'; APOC 1; ApoC I; ApoC-IB; ApoC-IB'; APOC1; APOC1_HUMAN; APOC1B; Apolipoprotein C I; Apolipoprotein C I variant I; Apolipoprotein C-I; Apolipoprotein C1; Apolipoprotein CI; ApolipoproteinC I; ApolipoproteinCI; Truncated apolipoprotein C-I
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
27-83aa
Target Protein Sequence
TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.
Gene References into Functions
  1. PPARgamma knockdown resulted in increased levels of TOMM40, APOE and APOC1 -mRNAs, showing the strongest impact on APOE transcript levels. PMID:28065845
  2. Collectively, these findings suggest that apoC1 and apoE have redundant functions in the hepatitis C virus (HCV) infection and morphogenesis. PMID:30130702
  3. the relationship between two variants of apoC1 and the risk of polycystic ovary syndrome, evaluated the genotypic effects on clinical, hormonal and metabolic indexes and plasma platelet-activating factor acetylhydrolase (PAF-AH) activity, was investigated. PMID:29636060
  4. Performance metrics were used to select SNPs in stage 1, which were then genotyped to another dataset (stage 2). Four SNPs (CPXM2 rs2362967, APOC1 rs4420638, ZNF521 rs7230380, and rs12965520) were identified for LOAD by both traditional P-values (without correcting for multiple tests) and performance metrics. PMID:27805002
  5. ApoC-I polymorphism might be one of the genetic factors of longevity in Bama; the ApoC-I rs4420638 and rs584007 SNPs are associated with serum triglycerides and high-density lipoprotein-cholesterol levels in the longevous population PMID:28486432
  6. Among white women, three single nucleotide polymorphisms (SNPs) (rs2075650 [TOMM40], rs4420638 [APOC1], and rs429358 [APOE]) were significantly associated with survival to 90 years after correction for multiple testing (p < .001); rs4420638 and rs429358 were also significantly associated with healthy aging (p = .02). In African American women, no SNP was associated with longevity. In Hispanic women, 7 SNPs in linkage dise PMID:27707806
  7. APOC1 expression induces glomerulosclerosis, potentially by increasing the cytokine response in macrophages. PMID:27976371
  8. apoC-I inhibited in situ LPL activity in adipocytes in both a concentration- and time-dependent manner. There was no change in postprandial WAT apoC-I secretion. WAT apoC-I secretion may inhibit WAT LPL activity and promote delayed chylomicron clearance in overweight and obese subjects PMID:27040450
  9. People with allelic variation in four genes related to cardiovascular diseases and metabolism were more likely to die: apolipoprotein (APO)C1 GG and AG carriers, APOE varepsilon4 carriers, insulin-degrading enzyme (IDE) TC carriers, and phosphatidylinositol 3-kinase (PI3KCB) GG carriers. PMID:27806189
  10. Common single-nucleotide polymorphism in the APOC1/APOE region, previously found to be associated with protective levels of cholesterol and lower cardiovascular risk, may be associated with ideal health. PMID:27179730
  11. These findings indicated that variants in TOMM40/APOE/APOC1 region might be associated with human longevity. Further studies are needed to identify the causal genetic variants influencing human longevity. PMID:26657933
  12. These results suggest that ApoC-I peptides may be a potential diagnostic biomarker and therapeutic approach for breast cancer. PMID:27052600
  13. APOC1 SNP is associated with the A beta-42 levels in CSF. PMID:26576771
  14. This sbioinformatics analysis explored the shared genetic etiology underlying Type 2 Diabetes and Alzheimer's Disease on SNP level, gene level, and pathway level. Six SNPs on APOC1 gene. PMID:26639962
  15. The endogenous retroviral promoters (LTRs) of the human endothelin B receptor (EDNRB) and apolipoprotein C1 (APOC1) genes have high sequence identity but differ in activity and tissue specificity. PMID:12805445
  16. The ability of apoC1 to inhibit CETP activity is impaired in patients with diabetes. Glycation of apoC1 leads to a change in its electrostatic properties that might account, at least in part, for a loss of constitutive CETP inhibition and an increase in plasma CETP activity in patients with diabetes. PMID:24574346
  17. APOE e4 allele status is associated with dementia and severity of Alzheimer's disease pathologic features in Parkinson disease. PMID:24582705
  18. Data indicate that apolipoprotein C-I (APOC1) rs11568822 polymorphism was associated with increased Alzheimer's disease (AD) risk in Caucasians, Asians and Caribbean Hispanics, but not in African Americans. PMID:24498013
  19. results suggest that peptide-lipid interactions drive alpha-helix binding to and retention on lipoproteins PMID:23670531
  20. apoC-I and apoC-III inhibit lipolysis by displacing LPL from lipid emulsion particles. We also propose a role for these apolipoproteins in the irreversible inactivation of LPL by factors such as angptl4. PMID:24121499
  21. Following regression analysis adjusted by collection center, gender, duration of diabetes, and average HbA1c, two SNPs were significantly associated with DN. rs4420638 in the APOC1 region and rs1532624 in CETP. PMID:23555584
  22. Linkage disequilibrium between APOC1 and TOMM40 is found in patients with primary progressive aphasia but not in controls or patients with frontotemporal dementia. PMID:22710912
  23. High concentrations of ApoCI are associated with increased triglycerides and decreased visceral fat mass in men with metabolic syndrome X. PMID:18835943
  24. Increased white adipose tissue apoC-I secretion in obese women is associated with delayed postprandial dietary fat clearance mediated by increased triglyceride rich apoC-I. PMID:22995522
  25. The plasma level of apoC-I was significantly increased in obese individuals compared with healthy individuals. PMID:22404376
  26. apoC1 as a CETP inhibitor no longer operates on cholesterol redistribution in high-risk patients with dyslipidemia PMID:22474067
  27. The observed increase in apoC-I interface affinity due to higher degrees of apoC-I-palmitoyloleoylphosphatidylcholine/triolein/water interactions may explain how apoC-I can displace larger apolipoproteins, such as apoE, from lipoproteins. PMID:22264166
  28. our approach, which is applicable to any set of interval scale traits that is heritable and exhibits evidence of phenotypic clustering, identified three new loci in or near APOC1, BRAP, and PLCG1, which were associated with multiple phenotype domains. PMID:22022282
  29. Results describe the association of ACE and APOC1 gene polymorphisms with susceptibility to Alzheimer's disease and dementia in general, both alone and combined with the APOE gene. PMID:21533863
  30. variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits PMID:21943158
  31. Serum levels of apoC-I and apoC-III combined with other clinical parameters can serve as a basis for the formulation of a diagnostic score for stomach cancer patients PMID:21267442
  32. New isoforms of apoC-I, were detected in the cohort of individuals with coronary artery disease using mass spectrometry while the expected apoC-I isoforms were absent. PMID:21187063
  33. This study examines the association between APOE/C1/C4/C2 gene cluster variation using tagging single nucleotide polymorphisms and plasma lipid concentration along with risk of coronary heart disease in a prospective cohort. PMID:20498921
  34. data show that apoCI genotype is associated with serum levels of triglycerides and CRP, confirming the role of apoCI in lipid metabolism and suggesting that it also influences inflammation PMID:20580041
  35. From genetic association studies in Canadian Oji-Cree subjects, APOC1 T45S polymorphism may be linked to obesity, adipocyte regulation, body fat, waist circumference, hyperglycemia, and plasma leptin and apolipoprotein C-I levels. PMID:19812053
  36. Apolipoprotein C-I reduces cholesteryl esters selective uptake from LDL and HDL by binding to HepG2 cells and lipoproteins PMID:19761869
  37. ApoC-I may have an important role in glucose and lipid metabolism and may be useful for early demonstration of metabolic abnormality in women with polycystic ovary syndrome. PMID:19368908
  38. ApoE e4 and APOC1 A alleles have a better association with Alzheimer disease than ApoE e4 alone. PMID:20145290
  39. Results identified haptoglobin alpha-1, apolipoprotein C-I and apolipoprotein C-III as candidate biomarkers in PTC. PMID:19785722
  40. Cholesteryl ester transfer protein is the sole major determinant of cholesteryl ester transfer in normolipidemic rabbit plasma as a result of the inability of rabbit apoCI to change HDL electronegativity. PMID:19417222
  41. APOC1 might be an additional susceptibility gene for late onset Alzheimer disease. PMID:11825674
  42. regulated expression of gene cluster in macrophages PMID:12032151
  43. Thermal unfolding of discoidal complexes of apolipoprotein (apo) C-1 with dimyristoyl phosphatidylcholine (DMPC) reveals a novel mechanism of lipoprotein stabilization that is based on kinetics rather than thermodynamics. PMID:12044170
  44. Effects of mutations in apolipoprotein C-1 on the reconstitution and kinetic stability of discoidal lipoproteins. PMID:12705839
  45. The effect of APOC1 genes on brain MRI measures were studied in subjects with age-associated memory impairment. The effects of APOC1 on hippocampal volumes appeared to be more robust than those of the APOE polymorphism. PMID:12736801
  46. overexpression of APOC1 prevents rosiglitazone-induced peripheral fatty acid uptake leading to severe hepatic steatosis PMID:14523051
  47. overexpression of apoCI does not represent a suitable method for decreasing total CE transfer activity in CETP/apoCI transgenic mice, owing to an hyperlipidaemia-mediated effect on CETP gene expression PMID:15339254
  48. apoC-I is a potent inhibitor of LPL-mediated triglyceride lipolysis PMID:15576844
  49. role of apolipoprotein C1 in the infection process of hepatitis C virus PMID:15767578
  50. Results suggested that both apoE and apoCI on chromosome 19 were the susceptibility loci for coronary artery disease, their linkage disequilibrium should be responsible for the development of coronary artery disease . PMID:15793777

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Apolipoprotein C1 family
Tissue Specificity
Synthesized mainly in liver and to a minor degree in intestine. Also found in the lung and spleen.
Database Links

HGNC: 607

UNIGENE: Hs.110675

KEGG: hsa:341

STRING: 9606.ENSP00000252491

OMIM: 107710

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products