Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
Angiopoietin-like protein 4Hepatic fibrinogen/angiopoietin-related protein ;HFARP
Species
Homo sapiens (Human)
Expression Region
28-403aa
Target Protein Sequence
VQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAE
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP101444h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ANGPTL4.
-
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP101444h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ANGPTL4.
Description
A cDNA ORF corresponding to the peptide of Human Angiopoietin-related protein 4 (ANGPTL4) was expressed with an N-terminal GST-tag in E.coli. ANGPTL4 CSB-EP866314HU1 is a truncated molecule having amino acid residues of Val28-Glu403. Its purity is greater than 90% as measured by SDS-PAGE. A molecular mass band of 88 about kDa was presented on the SDS-PAGE gel under reducing conditions. It was also validated by the LC-MS/MS analysis. This recombinant ANGPTL4 protein may be not only used for specific antibody production but also applied in the studies of cardiovascular diseases.
ANGPTL4 is a secreted protein with multiple functions. It participates in various biological processes, such as lipid metabolism, angiogenesis, and vascular permeability, cell differentiation, glucose, and energy homeostasis, wound healing, inflammation, redox regulation, and tumorigenesis. The ANGPTL4-high expression has demonstrated to be related to poor prognostic outcome in patients with various solid tumors. This may suggest the involvement of ANGPTL4 in cancer onset and progression, metastasis, and anoikis resistance.