Abbreviation
Recombinant Human/Cynomolgus monkey ACVR2B protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human INHBA(CSB-MP011719HU1b0) at 2 μg/mL can bind Human ACVR2B.The EC50 is 45.93-52.42 ng/mL.
Alternative Names
Activin receptor type-2B; EC:2.7.11.30; Activin receptor type IIB (ACTR-IIB); ACVR2B
Species
Homo sapiens (Human)
Expression Region
19-137aa
Target Protein Sequence
SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-Flag-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human INHBA(CSB-MP011719HU1b0) at 2 μg/ml can bind Human ACVR2B.The EC50 is 45.93-52.42 ng/mL.
-
The purity of ACVR2B was greater than 95% as determined by SEC-HPLC
Description
Activin receptor type-2B mediates signaling by activin and related TGF-β superfamily ligands, making it a critical node in pathways governing muscle homeostasis, metabolism, and bone remodeling. This mammalian-expressed extracellular domain (residues 19–137) demonstrates quantified binding to immobilized human inhibin βA with an EC50 of 45.93–52.42 ng/mL in functional ELISA, providing a validated basis for ligand-receptor interaction studies, competitive inhibition assays, and blocking antibody screening campaigns. The measured affinity supports its use as a positive control in binding platforms including surface plasmon resonance and biolayer interferometry, as well as in therapeutic antibody epitope mapping where native glycosylation and tertiary structure are essential for physiologically relevant epitope presentation. Dual SDS-PAGE and SEC-HPLC purity exceeding 95%, combined with endotoxin levels below 1.0 EU/μg, aligns with standards expected in drug discovery workflows targeting activin–ACVR2B interactions for muscle-wasting and metabolic disorders.
