Home
Product
Protein
Recombinant Proteins
Recombinant Human HLA class I histocompatibility antigen, alpha chain E (HLA-E), partial

Recombinant Human HLA class I histocompatibility antigen, alpha chain E (HLA-E), partial

CSB-EP320269HU

Rate （N/A）
Review （0）

Size:

20ug100ug1mg(1mg*1 or 500ug*2)

US$224

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: N-terminal 6xHis-SUMO-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

HLA-E

Uniprot NO.

P13747

Research Area

Immunology

Alternative Names

MHC class I antigen E

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

22-305aa

Target Protein Sequence

GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI

Mol. Weight

48.7kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-SUMO-tagged

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

The N-terminal 6xHis-SUMO-tagged recombinant human HLA-E is expressed in E.coli. Its expression region maps within amino acids 22-305 (extracellular domain) of the human HLA-E. Its purity is greater than 90% measured by SDS-PAGE. It migrated to the molecular weight band of approximately 50 kDa on the gel. This recombinant human HLA-E protein is available now. The target protein HLA-E exerts a very specialized role in cell recognition by NK cells.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

■ Q&A

1.Is the 6xHis-SUMO tag retained or is it cleaved after your expression?
2.Has this molecule been shown to bind to anti-HLA-E and anti-HLA-ABC (pan class I) antibodies?

Thanks for your inquiry.1. If you needs to remove the tag, please communicate with us in advance, otherwise, we won't remove the tag. Not all protein tags can be removed as some proteins will be very unstable after tag removal. If we succeed in removing the tag, we will charge for extra cost.
If we fail in removing the tag, we won’t charge for any extra cost, and remark this information in datasheet as follows “Note: The laboratory determined that the Tag on your protein could not be removed with standard laboratory procedures. Your protein is being supplied with the Tag intact.”
Generally, the delivery time will be extended for 2-3 days.
2. This protein can bind to anti-HLA-E and anti-HLA-ABC (pan class I) antibodies in theory, but we haven't performed relevant validation. It is suggested that antibodies and antigens are derived from the same recombinant expression system, because the conformation of proteins expressed by different recombinant expression systems will be different, which may lead to difference in recognition.

I hope this email finds you well. I am interested in this protein but they would like to know more information regarding its biological activity. Is this information available for me to share?

Very nice to receive your inquiry.
We haven't tested the biological activity of this protein. The protein we provide is the complete extracellular domain purified under mild conditions which should have activity in theory.
This protein has been delivered for many times. Any more questions, feel free to contact us.

Target Background

Function

Non-classical major histocompatibility class Ib molecule involved in immune self-nonself discrimination. In complex with B2M/beta-2-microglobulin binds nonamer self-peptides derived from the signal sequence of classical MHC class Ia molecules (VL9 peptides). Peptide-bound HLA-E-B2M heterotrimeric complex primarily functions as a ligand for natural killer (NK) cell inhibitory receptor KLRD1-KLRC1, enabling NK cells to monitor the expression of other MHC class I molecules in healthy cells and to tolerate self. Upon cellular stress, preferentially binds signal sequence-derived peptides from stress-induced chaperones and is no longer recognized by NK cell inhibitory receptor KLRD1-KLRC1, resulting in impaired protection from NK cells. Binds signal sequence-derived peptides from non-classical MHC class Ib HLA-G molecules and acts as a ligand for NK cell activating receptor KLRD1-KLRC2, likely playing a role in the generation and effector functions of adaptive NK cells and in maternal-fetal tolerance during pregnancy. Besides self-peptides, can also bind and present pathogen-derived peptides conformationally similar to VL9 peptides to alpha-beta T cell receptor (TCR) on unconventional CD8+ cytotoxic T cells, ultimately triggering antimicrobial immune response.; (Microbial infection) Viruses like human cytomegalovirus have evolved an escape mechanism whereby virus-induced down-regulation of host MHC class I molecules is coupled to the binding of viral peptides to HLA-E, restoring HLA-E expression and inducing HLA-E-dependent NK cell immune tolerance to infected cells.; (Microbial infection) May bind HIV-1 gag/Capsid protein p24-derived peptide (AISPRTLNA) on infected cells and may inhibit NK cell cytotoxicity, a mechanism that allows HIV-1 to escape immune recognition.; (Microbial infection) Upon SARS-CoV-2 infection, may contribute to functional exhaustion of cytotoxic NK cells and CD8-positive T cells. Binds SARS-CoV-2 S/Spike protein S1-derived peptide (LQPRTFLL) expressed on the surface of lung epithelial cells, inducing NK cell exhaustion and dampening antiviral immune surveillance.

Gene References into Functions

Data suggest that, although different T-cell receptors adopt distinct docking modes on HLAE, energetic basis of T-cell receptor interaction is defined by set of conserved HLAE residues. PMID:28972140
It indicates that HLA-E expression may have an immunomodulatory effect and a possible role in the severity of liver disease in chronic hepatitis C. PMID:29951556
HLA-E is highly represented in ovarian carcinoma suggesting a potential association with progressive disease mechanism PMID:29499226
Soluble HLA-E level is useful as a biomarker of disease activity and course in Takayasu arteritis patients. rs1264457 polymorphism is neither associated with susceptibility nor did it influence sHLA-E levels in TA. PMID:28425192
The frequency of the HLA-E*0101/*0103X genotype in male patients with Pemphigus Vulgaris was found to be significantly higher than in men in the control group (P=0.023). PMID:29252170
These data suggest that HLA-E overexpression frequently occurs in renal cell carcinoma and correlates with reduced immunogenicity PMID:27589686
HLA-E restricted CD8+ T cells may represent an important subset of pTregs, suppressing previously activated target cells. PMID:24144875
No specific HLA-G and HLA-E haplotypes were significantly associated with increased risk of developing severe preeclampsia/eclampsia. PMID:27596021
Our findings provide evidence that during renal allograft rejection HLA-E along with high numbers of mismatched HLA-class I leader peptides might represent additional targets for immune-activating responses. PMID:27871782
The results suggest that HLA-E allelic variants may play a role in the modulation of immune responses in the context of the inability of natural conception and establishment of a viable pregnancy. PMID:27714943
The prognostic benefit of natural killer cells, but not T-cells, is influenced by HLA-E expression in endometrial cancer. PMID:29059634
This data reinforces the presence of only two main full-length HLA-E molecules encoded by the many HLA-E alleles detected in our population sample. In addition, this data does indicate that the distal HLA-E promoter is by far the most variable segment. PMID:28946074
HLA-E alleles and sHLA-E levels may represent novel biomarkers for early disease progression in patients with chronic lymphocytic leukemia PMID:27859015
In insulitic islets from living patients with recent-onset T1D, most of the overexpressed ISGs, including GBP1, TLR3, OAS1, EIF2AK2, HLA-E, IFI6, and STAT1, showed higher expression in the islet core compared with the peri-islet area containing the surrounding immune cells PMID:27422384
soluble HLA-Ib molecules HLA-G and HLA-E are present in BM plasma samples in physiological and pathological conditions, and their concentration correlated with stage disease in NB patients. PMID:27610393
this study shows the high expression of HLA-E in actinic chelitis and in lip squamous cell carcinoma, which reflects the capacity that these pathologies have for evasion and progression PMID:26723902
Our study reveals that HLA-E polymorphism is associated with nasopharyngeal cancer. PMID:26896927
High expression of HLA-E is associated with non-small cell lung carcinoma. PMID:26658106
The positive correlation has been found between the HLA-E*01:01/01:03 A>G polymorphism, plasma HLA-E level, and advanced fibrosis stages in chronic hepatitis B patients. PMID:26956431
the promoter region of the HLA-E gene presents few and rare variable sites in Brazilian population sample. PMID:26596885
HLA-E regulates NKG2C+ natural killer cell function through presentation of a restricted peptide repertoire PMID:26382247
HLA-E is capable of presenting a highly conserved peptide from HIV-1 capsid (AISPRTLNA) that is not recognized by NKG2A/CD94. PMID:26828202
over-expression of HLA-E is associated with melanoma PMID:26090591
Peptide-induced HLA-E expression in human PBMCs is dependent on peptide sequence and the HLA-E genotype. PMID:25735891
this study suggests that minor histocompatibility antigens presented by HLA-E can represent an additional risk factor following lung transplantation. PMID:26302084
These results indicate that E*01:01 is a novel protective genetic factor in EBV-associated cHL and support a role for HLA-E recognition on the control of EBV infection and lymphomagenesis. PMID:26261988
HLA-E molecules traffic differently from the HLA-class I molecules and can play a fundamental role in the protection against intracellular pathogens and susceptibility to several diseases. PMID:26310830
Functional differences and the immunological impact of HLA-E allelic variant Arg107Gly PMID:26552660
increased risk of recurrent miscarriage in mothers carrying HLA-E*01:01 allele; meta-analysis PMID:25700963
The results derived from this study imply that HLA-E polymorphisms may influence RA susceptibility and affect clinical outcome of anti-TNF therapy in female RA patients. PMID:26307125
genetic polymorphism is not associated with nasopharyngeal carcinoma in China PMID:25636564
genetic polymorphism does not affect treatment outcome following allogeneic hematopoietic stem cell transplantation in Egyptian patients PMID:25543014
Monoclonal antibodies to HLA-E bind epitopes carried by unfolded beta2 m-free heavy chains. PMID:25982269
We identified that the HLA-E and HLA-F in gastric cancer independently affected clinical factors, including postoperative outcome PMID:25862890
HLA-E gene polymorphisms are associated with the development of breast cancer in women of Han polulation. PMID:25854574
HLA-E*0103 allele is associated with susceptibility to serous ovarian cancer in a Chinese Han population. PMID:25711417
Review of the impact of human leukocyte antigen molecules E, F, and G on the outcome of transplantation. PMID:25420801
IL-12-producing monocytes and HLA-E control HCMV-driven NKG2C+ NK cell expansion. PMID:25384219
novel insights in the mechanism via which HLA-E expression levels are controlled and how the cellular immune response in transplantation and cancer is influenced by HLA-E. PMID:25413103
Results show that HLA-E and KIR2DL4 demonstrate evidence of positive selection between human, chimpanzee and gorilla suggesting a main role for immunological adaptations linked to embryo deep invasion of the maternal endometrium during pregnancy. PMID:25451741
Studies suggest that HLA class I molecule HLA-E to be a ligand for the innate and adaptive immune system. PMID:25401109
Sera from early-onset, severely preeclamptic women directly modulate HLA-E expression in the EA.hy296 endothelial cell line. PMID:24837231
Findings indicate that HLA-E up-regulation in 3D-cultured cells may result in enhanced tumor resistance to NK cell-mediated immune response. PMID:24742303
The expression levels of HLA-G or HLA-E alone and the combined expression of both molecules were all statistically correlated with the overall survival of colorectal cancer patients. PMID:25461612
Transgenic hCD46/HLA-E expression reduced humoral xenoresponses since all were downregulated during ex vivo xenoperfusion of hCD46/HLA-E double transgenic pig forelimbs with human blood. PMID:24635052
IL-27 driven upregulation of surface HLA-E expression on monocytes inhibits IFN-gamma release by autologous NK cells. PMID:24741633
NKG2C receptor deletion and a functional polymorphism in its ligand HLA-E may play a role in psoriasis susceptibility PMID:24079744
surface HLA-E was higher on melanoma cells than on melanocytes and protected the former (6/6 cell lines) from lysis by natural killer (NK) cells, functionally counteracting co-expressed triggering ligands. PMID:24011128
These results indicate that generating transgenic HLA-E pigs might protect porcine grafts from, not only NK cytotoxicity, but also macrophage-mediated cytotoxicity. PMID:23994719
Data suggest that the cell-surface HLA class I molecules HLA-E, HLA-C, and HLA-G co-localize with each other on trophoblast cell membranes and have the potential to form preferential heterotypic associations that may be modulated by progesterone. PMID:24006284

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein. Golgi apparatus membrane.; [Soluble HLA class I histocompatibility antigen, alpha chain E]: Secreted.

Protein Families

MHC class I family

Tissue Specificity

Expressed in secretory endometrial cells during pregnancy (at protein level). The expression in nonlymphoid tissues is restricted to endothelial cells from all types of vessels, including arteries, veins, capillaries, and lymphatics (at protein level). In

Database Links

HGNC: 4962

UNIGENE: Hs.650174

KEGG: hsa:3133

STRING: 9606.ENSP00000365817

OMIM: 143010

Promotions