Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
sod1; cuzn; Superoxide dismutase [Cu-Zn]; EC 1.15.1.1
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Expression Region
1-154aa
Target Protein Sequence
MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description
The region for expressing recombinant Zebrafish sod1 contains amino acids 1-154. This sod1 protein is theoretically predicted to have a molecular weight of 37.1 kDa. This sod1 recombinant protein is manufactured in e.coli. The sod1 coding gene included the N-terminal 10xHis-SUMO tag and C-terminal Myc tag, which simplifies the detection and purification processes of the recombinant sod1 protein in following stages of expression and purification.
Superoxide dismutase [Cu-Zn] (Sod1) in Danio rerio, commonly known as zebrafish, is an essential antioxidant enzyme that plays a crucial role in the defense against oxidative stress. This enzyme is characterized by its ability to catalyze the dismutation of superoxide radicals into oxygen and hydrogen peroxide, thereby protecting cells from the harmful effects of reactive oxygen species. Sod1 is primarily localized in the cytoplasm and is involved in maintaining cellular redox homeostasis. In zebrafish, as in other organisms, Sod1 is vital for various physiological processes, including embryonic development, immune response, and overall cellular survival. Studying Sod1 in zebrafish contributes to a better understanding of the mechanisms underlying oxidative stress responses and provides insights into the role of this enzyme in development and disease.