Recombinant Chicken Insulin-like growth factor I (IGF1)

CSB-YP011086CH
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$276
Quantity:
Express system: Yeast
Species: Gallus gallus (Chicken)
Tag Info: N-terminal hFc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Target Names
IGF1
Uniprot NO.
Research Area
Cancer
Species
Gallus gallus (Chicken)
Source
Yeast
Expression Region
49-118aa
Target Protein Sequence
GPETLCGAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSA
Mol. Weight
34.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal hFc-tagged
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of IGF1 was greater than 90% as determined by SEC-HPLC
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling.
Gene References into Functions
  1. It is a protein synthesis-related factor. PMID:28594135
  2. The coding region of the IGF1 gene was polymorphic, expressed differentially during the pre-hatch and post-hatch periods, and haplogroups showed significant association with growth traits in chicken. PMID:26059224
  3. The IGF-I gene is significantly associated with some growth traits (body weight at hatching, and at 4, 8, 12, and 14 weeks of age) in chickens. PMID:23546986
  4. IGF1 single-nucleotide polymorphism c.47673G > A was associated with body weight and haematocrit percentage, and also with feed intake and percentages of abdominal fat and gizzard genotype x sex interactions. PMID:23275255
  5. Insulin-like growth factor 1 stimulates Non-astrocytic Inner Retinal Glial cells to proliferate, migrate distally into the retina, and become reactive. PMID:22973454
  6. The objective of this study was to examine associations of an IGF1 promoter polymorphism with growth, body composition, skeleton integrity, and metabolic traits in chickens. PMID:15742956
  7. Genetic/nutritional models show a positive relation between muscle IGF-1 mRNA levels, which determine paracrine IGF-1 levels, and post hatch muscle growth. (Review) PMID:16077194
  8. These results suggest that the mechanism of action whereby IGFBP2 excess impairs long bone development is to inhibit IGF-I and IGF-II mediated proliferation and matrix synthesis. PMID:16183342
  9. Polymorphisms within the IGF1 gene are associated with 5-week body weight. PMID:16734694
  10. Blood levels ofIGF-I may be more important than IGF-II after chicken hatching PMID:17369538
  11. Data show that transcription level of IGF-1 decreased dramatically in the sex-linked dwarf. PMID:17681929
  12. Association analysis showed that haplotypes based on three cIGF1 polymorphisms (c.-366A>C, c.528G>A and c.*1024C>T) were associated with body weight traits, suggesting that cIGF1 or a tightly linked gene had effects on body weight in the chicken. PMID:18717967
  13. IGF-1 genes and proteins are expressed at high or moderately high levels in healing tendon PMID:19084187

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Insulin family
Database Links

UNIGENE: Gga.850

KEGG: gga:418090

STRING: 9031.ENSGALP00000020787

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products