Home
Product
Protein
Recombinant Proteins
Recombinant Chicken Insulin-like growth factor I (IGF1)

Recombinant Chicken Insulin-like growth factor I (IGF1)

CSB-YP011086CH

Rate （N/A）
Review （0）

Size:

20ug100ug1mg(1mg*1 or 500ug*2)

US$276

Quantity:

Express system: Yeast

Species: Gallus gallus (Chicken)

Tag Info: N-terminal hFc-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.

Target Names

IGF1

Uniprot NO.

P18254

Research Area

Cancer

Species

Gallus gallus (Chicken)

Source

Yeast

Expression Region

49-118aa

Target Protein Sequence

GPETLCGAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSA

Mol. Weight

34.4 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal hFc-tagged

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of IGF1 was greater than 90% as determined by SEC-HPLC

Description

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function

The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling.

Gene References into Functions

It is a protein synthesis-related factor. PMID:28594135
The coding region of the IGF1 gene was polymorphic, expressed differentially during the pre-hatch and post-hatch periods, and haplogroups showed significant association with growth traits in chicken. PMID:26059224
The IGF-I gene is significantly associated with some growth traits (body weight at hatching, and at 4, 8, 12, and 14 weeks of age) in chickens. PMID:23546986
IGF1 single-nucleotide polymorphism c.47673G > A was associated with body weight and haematocrit percentage, and also with feed intake and percentages of abdominal fat and gizzard genotype x sex interactions. PMID:23275255
Insulin-like growth factor 1 stimulates Non-astrocytic Inner Retinal Glial cells to proliferate, migrate distally into the retina, and become reactive. PMID:22973454
The objective of this study was to examine associations of an IGF1 promoter polymorphism with growth, body composition, skeleton integrity, and metabolic traits in chickens. PMID:15742956
Genetic/nutritional models show a positive relation between muscle IGF-1 mRNA levels, which determine paracrine IGF-1 levels, and post hatch muscle growth. (Review) PMID:16077194
These results suggest that the mechanism of action whereby IGFBP2 excess impairs long bone development is to inhibit IGF-I and IGF-II mediated proliferation and matrix synthesis. PMID:16183342
Polymorphisms within the IGF1 gene are associated with 5-week body weight. PMID:16734694
Blood levels ofIGF-I may be more important than IGF-II after chicken hatching PMID:17369538
Data show that transcription level of IGF-1 decreased dramatically in the sex-linked dwarf. PMID:17681929
Association analysis showed that haplotypes based on three cIGF1 polymorphisms (c.-366A>C, c.528G>A and c.*1024C>T) were associated with body weight traits, suggesting that cIGF1 or a tightly linked gene had effects on body weight in the chicken. PMID:18717967
IGF-1 genes and proteins are expressed at high or moderately high levels in healing tendon PMID:19084187