Recombinant Bovine Muellerian-inhibiting factor (AMH), partial

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
AMH
Uniprot NO.
Alternative Names
AMH; Muellerian-inhibiting factor; Anti-Muellerian hormone; AMH; Muellerian-inhibiting substance; MIS
Species
Bos taurus (Bovine)
Source
E.coli
Expression Region
475-575
Target Protein Sequence
GPCALRELSVDLRAERSVLIPETYQANNCQGACGWPQSDRNPRYGNHVVLLLKMQARGATLARPPCCVPTAYTGKLLISLSEERISAHHVPNMVATECGCR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
partial
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.
Gene References into Functions
  1. Anti-Mullerian hormone inhibits activation and growth of bovine ovarian follicles in vitro and is localized to growing follicles. PMID:28333275
  2. This study showed that antral follicle counts (AFC) and AMH levels were repeatable when determined at an unknown stage of follicular growth and expected day of follicular wave emergence, but repeatability was greater for AMH than AFC. PMID:28237349
  3. The effects of castration and other surgical intervention on the blood levels of anti-Muellerian hormone, inhibin A, gonadotropins, and gonadotropin receptors in bull calves are reported. PMID:27693012
  4. Results from these studies indicate that AMH signaling plays a role in both regulating granulosa cell proliferation and preventing granulosa cells from 5- to 8-mm follicles from undergoing premature differentiation before follicle selection. PMID:27268296
  5. These findings indicate the followings: AMH mRNA levels decrease in both dominant and secondary follicles during follicular deviation; granulosa cells from heathy follicles express more AMH mRNA compared to subordinate follicles undergoing atresia and FSH stimulates AMH and AMHR2 mRNA expression in granulosa cells of co-dominant follicles. PMID:26815645
  6. Measurement of AMH concentration in the plasma of cows can help to predict their capacity for embryo production in response to gonadotrophin treatment. PMID:22935154
  7. In first study to investigate the blood profile and immunohuistochemistry of anti-Mullerian hormone in bovine granulosa-theca cell tumors, the findings indicated that anti-Mullerian hormone is a novel biomarker for granulosa-theca cell tumors in cattle. PMID:22052009
  8. Regulation of anti-Mullerian hormone production in the cow. PMID:21076084
  9. Intrafollicular AMH was not a marker of cystic development in the cow, but low AMH concentrations in cysts were associated with luteinization. PMID:18448844
  10. AMH expression is modulated by androgens in bovine granulosa cells from small follicles. PMID:19714502

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
TGF-beta family
Database Links

UNIGENE: Bt.7050

KEGG: bta:280718

STRING: 9913.ENSBTAP00000019912

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1