Home
Product
Protein
Recombinant Proteins
Recombinant Bovine Muellerian-inhibiting factor (AMH), partial

Recombinant Bovine Muellerian-inhibiting factor (AMH), partial

Baculovirus
Mammalian cell

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

AMH

Uniprot NO.

P03972

Species

Bos taurus (Bovine)

Source

E.coli

Expression Region

475-575

Target Protein Sequence

GPCALRELSVDLRAERSVLIPETYQANNCQGACGWPQSDRNPRYGNHVVLLLKMQARGATLARPPCCVPTAYTGKLLISLSEERISAHHVPNMVATECGCR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

partial

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.

Gene References into Functions

Anti-Mullerian hormone inhibits activation and growth of bovine ovarian follicles in vitro and is localized to growing follicles. PMID:28333275
This study showed that antral follicle counts (AFC) and AMH levels were repeatable when determined at an unknown stage of follicular growth and expected day of follicular wave emergence, but repeatability was greater for AMH than AFC. PMID:28237349
The effects of castration and other surgical intervention on the blood levels of anti-Muellerian hormone, inhibin A, gonadotropins, and gonadotropin receptors in bull calves are reported. PMID:27693012
Results from these studies indicate that AMH signaling plays a role in both regulating granulosa cell proliferation and preventing granulosa cells from 5- to 8-mm follicles from undergoing premature differentiation before follicle selection. PMID:27268296
These findings indicate the followings: AMH mRNA levels decrease in both dominant and secondary follicles during follicular deviation; granulosa cells from heathy follicles express more AMH mRNA compared to subordinate follicles undergoing atresia and FSH stimulates AMH and AMHR2 mRNA expression in granulosa cells of co-dominant follicles. PMID:26815645
Measurement of AMH concentration in the plasma of cows can help to predict their capacity for embryo production in response to gonadotrophin treatment. PMID:22935154
In first study to investigate the blood profile and immunohuistochemistry of anti-Mullerian hormone in bovine granulosa-theca cell tumors, the findings indicated that anti-Mullerian hormone is a novel biomarker for granulosa-theca cell tumors in cattle. PMID:22052009
Regulation of anti-Mullerian hormone production in the cow. PMID:21076084
Intrafollicular AMH was not a marker of cystic development in the cow, but low AMH concentrations in cysts were associated with luteinization. PMID:18448844
AMH expression is modulated by androgens in bovine granulosa cells from small follicles. PMID:19714502