Recombinant Bovine Adiponectin (ADIPOQ)

Mammalian cell

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

ADIPOQ

Purity

>85% (SDS-PAGE)

Target Names

ADIPOQ

Uniprot NO.

Q3Y5Z3

Research Area

Others

Alternative Names

ADIPOQ; ACRP30; APM1Adiponectin; 30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte; C1q and collagen domain-containing protein; Adipose most abundant gene transcript 1 protein; apM-1

Species

Bos taurus (Bovine)

Source

Baculovirus

Expression Region

18-240aa

Target Protein Sequence

EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

26.4kD

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.

Gene References into Functions

These data suggest that energy balance around parturition may regulate plasma adiponectin but do not support roles for lipid mobilization or sustained changes in the plasma concentration of leptin, insulin, growth hormone, or fatty acids. PMID:28843695
Low level expression of adiponectin mRNA was found in all areas of bovine mammary gland tissues examined. AdipoR1 and AdipoR2 mRNAs were also detected in mammary tissues and their expression was particularly prominent in the parenchyma and cistern. PMID:25676879
Data suggest that genetic variation in promoter region of ADIPOQ (SNPs g.81966235C>T, g.81966377T>C, and g.81966364D>I) contribute to adiposity/marbling in skeletal muscle/meat (and thus meat quality) of Hanwoo beef cattle of North Korea. PMID:25817801
These data suggest differential contribution of adipose tissue depots to circulating adiponectin. PMID:24462180
Association analysis indicated that variable duplication within the ADIPOQ gene is associated with body measurements. PMID:24341634
14 polymorphisms of the ADIPOQ gene were observed in Chinese cattle; 2 polymorphisms PR_-135 A>G and PR_-68 G>C were located in the core promoter region of ADIPOQ; 3 haplotypes in the 2 polymorphic sites were detected which produce effects on ADIPOQ transcription and are associated with growth traits PMID:24099391
reduced plasma adiponectin belongs to the subset of hormonal adaptations in EL dairy cows facilitating mammary glucose uptake via promotion of insulin resistance PMID:23077076
The physiologic status of the ovary has significant effects on the natural expression patterns of adiponectin and its receptors in follicular and luteal cells of bovine ovary. PMID:20047754
The disulfide bonds help to maintain the mature octadecameric adiponectin structure and stabilize intermediates during the assembly. PMID:19943704
Gobular adiponectin increased NO production in aortic endothlium by increasing NO synthase activity. PMID:14551684
A 5bp deletion mutation within the bovine ACRP30 gene was firstly detected and confirmed in 991 cattle . PMID:18446445
results indicate decreasing adiponectin sensitivity in adipose tissue after calving which might be involved in the reduced insulin sensitivity of adipose tissue during lactation PMID:19345551
Adiponectin gene was proved to be closely related to carcass and meat quality traits (P < 0.05), which can be used as a candidate molecular marker for production of high-grade meat in Qinchuan beef cattle. PMID:19840922